KEGG   Prevotella dentalis: Prede_1938Help
Entry
Prede_1938        CDS       T02403                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pdt  Prevotella dentalis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Prede_1938
Enzymes [BR:pdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Prede_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(566338..567240)
Genome map
AA seq 300 aa AA seqDB search
MRRILVIGSSNTDMVIKSDRLPKPGETLLGGKFMMNPGGKGANQAVAASRLGGNVTFVCK
VGRDTFGKKARELFKEEGIDVSHILEDPEGNSGVALINVDSKGENCIVVAESTNDALTSK
DIESLTEVIKASDILVLQLEIPMESVVKAAEIAHAHGKKVILNPAPAPSQGFPAGFLSNI
DLIVPNETEASIISGIEVQSLEEAERAAKKIQEAGCKKVIVTLGSRGAMIANHEITVVPS
DKVEAVDTTAAGDTFCGALAVALSENMSLEEGTRFACHASAISVTRMGAQSSIPYRYEIK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatacttgtgataggaagcagtaacaccgatatggtgattaaatctgatcga
ttgcctaaaccgggcgaaacattgcttggaggaaaattcatgatgaatcctggaggaaag
ggggccaaccaagctgttgcagcctcccggctgggtggtaacgtaacgtttgtgtgcaaa
gttggtagggacacttttggcaagaaagcccgcgaattatttaaggaagagggtattgat
gtgtctcatattcttgaggatccagagggaaattctggggtagctttgattaatgtggac
agcaaaggggaaaactgcattgttgtagcagagagtactaacgatgcacttacttctaaa
gatattgaaagtctcacagaagttattaaagcttctgacattttagtccttcagttggaa
ataccaatggaatccgtagtaaaggctgcagagattgcgcatgcccatggaaaaaaagtg
atacttaatcctgcgcctgcgccgagccagggattccccgcgggctttctatccaatatc
gacctcattgttcccaatgagaccgaggcttcgattatttccggtattgaggtgcaaagc
ttggaagaagccgagagggcagcaaaaaagattcaagaagcaggctgtaagaaagttatt
gtcactcttggttcacgtggcgccatgatagcaaaccatgaaattacggtagttccatca
gacaaggtggaagcagtagataccactgcggcaggagatacgttctgcggagctttggct
gtagctctctcggaaaacatgtcattggaagagggtacacgttttgcctgccatgcttca
gctatatcagtgacacgcatgggtgcgcaatcatcaataccctataggtacgagataaaa
taa

DBGET integrated database retrieval system