KEGG   Prevotella dentalis: Prede_2024Help
Entry
Prede_2024        CDS       T02403                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pdt  Prevotella dentalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pdt00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pdt00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pdt00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(669317..671482)
Genome map
AA seq 721 aa AA seqDB search
MYCKLLTTLAVTCSLAAHADRLNICTRNLSLVVSADEGRQPEYVYFGSRLSDAESRALPV
PRGGRMDAYPAYGLNCPVPAALACRHADGNLSTQLVVTGTSQQGDLTTVRLRDPVYDLRV
DLKYRALADVDMIEAWAEITNGEKATVTLTGFASATLPIRRGDVWMSHLYGSWGNEGRVA
EEPLRPGEIVVANRDGVRNSATAHAELMFSLDGKARENSGRVIGAALCYSGNYRLRAITD
DSDYHYLMAGIDEQNSEYHLRRGETFATPCLALTFSREGLSGASRNFHRWGRRYRLMHGD
RERMVLLNSWEGVYMDVNQKGMDQMMADLADLGGELFVMDDGWFGQKYPRKRDDTALGDW
VVDREKLPEGIEGLLRDARRHGVKFGIWIEPEMTNTRSELYEKHPDWVVKAPRRDAVTGR
GGTQLVLDLGNPQVQDFVFSVVDRLMTAHPDIAYIKWDANMPVMNHGSQYLPMADQSHLN
IAYHRGLERVFRRIRAKYPDLVMQACASGGARANWGVLPYFDEFWVSDDTDALQRVYMQW
GTSYFFPAMAMASHISAAPNHQTARVIPLKYRIDVAMSGRLGMEIQPRNMTDAERDLCHK
AIGEYKQIRPIVQLGDIYRLQSPYDNKGVASLMYVTEARDKAVWYWWKTETFVNQHLPRI
PMAGLDPARTYTVRELNRVGRKPLACEGRQYSGAYLMEHGLEMPYTHDTGTAWASRVLLL
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtattgcaaacttctcactacgctcgccgtgacttgttcgctggcagcccatgccgac
cggctgaacatctgcacgcgcaacctctcgctggtggtcagtgccgacgagggacggcaa
cccgagtatgtctatttcggctcgcggctcagcgacgccgagagccgggccctgcccgtg
ccgcggggcggccgcatggacgcctacccggcctacggcctcaactgtccggtcccggcc
gcgctggcctgccgccacgccgacggcaacctgagcacgcagctcgtcgtaaccggcacg
tcgcagcagggcgacctcaccaccgtgcggctcagggacccggtgtacgacctgcgcgtg
gatctgaaataccgtgcgctggccgacgtggacatgattgaggcctgggccgaaatcacc
aatggcgagaaagccacggtgacgctcaccggctttgcctcggccacgctccccatccgc
cgcggcgacgtgtggatgagccacctctacggctcgtggggcaacgaggggcgcgtggcc
gaggagccgctgcggcccggcgaaatcgtggtggccaaccgcgacggcgtgcgcaactcg
gccaccgcccacgccgagctgatgttctcgctcgacggcaaggcccgcgagaacagcggc
cgcgtcatcggcgccgccctgtgctacagcggcaactaccgcctccgcgccatcaccgac
gacagcgactaccactacctcatggccggcatcgacgagcaaaactccgagtaccacctg
cgccgcggcgagaccttcgccacgccctgcctggccctcaccttctcgcgcgagggcctt
tcgggcgcgagccgcaacttccacaggtgggggcgccggtaccggctcatgcacggcgac
cgcgaacgcatggtgctgctcaactcgtgggagggcgtctacatggatgtgaaccagaaa
ggcatggaccagatgatggccgacctggccgacctgggcggcgaactcttcgtgatggac
gacggatggttcggccaaaagtatccgcgcaagcgcgacgacaccgcgctgggcgactgg
gtggtggaccgtgagaagctgcccgagggcatcgaaggcctgttgcgcgacgcgcgccgg
cacggcgtgaagttcggtatctggatagaacccgagatgaccaacacccgcagcgagctc
tacgagaagcatcccgactgggttgtcaaggctccgcggcgcgacgccgtgacgggacgc
ggcggcacgcagctggtgctcgacctgggcaacccgcaggtgcaggacttcgtcttctcc
gtcgtcgaccggctcatgacggcccatcccgacatcgcctacatcaagtgggacgccaac
atgccggtgatgaaccacggttcgcagtatctgcccatggccgaccagagccacctcaac
atcgcttaccaccgcggactggagcgcgtcttccggcgcatccgcgccaaataccccgac
ctcgtgatgcaggcatgcgccagcggcggcgccagggccaactggggcgtgctgccctac
ttcgacgagttctgggtaagcgacgacaccgacgccctgcagcgcgtctacatgcagtgg
ggcaccagctatttcttcccggccatggccatggcttcgcacatctcggccgcccccaac
caccagacggcccgcgtcatccccctcaaataccgcattgacgtggccatgagcggccgc
ctgggcatggagatacagccccgcaacatgaccgatgcggagcgcgacctctgccacaag
gccattggcgagtacaagcagatacggcccatcgtgcagctgggcgacatctatcggctg
cagagcccctacgacaacaagggcgtggcctcgctgatgtatgtcacggaggccagggac
aaggccgtgtggtactggtggaagacggagaccttcgtcaaccagcacctgccgcgcatc
cccatggccggcctcgacccggcgcgcacgtacaccgtgcgcgagctgaaccgcgtgggc
cgcaagcctctggcgtgcgaggggaggcagtacagcggcgcctatctcatggagcacggc
ctcgaaatgccctacacccacgacacgggcacggcctgggccagccgcgtgttgctgctc
gagtga

DBGET integrated database retrieval system