KEGG   Prevotella dentalis: Prede_2297Help
Entry
Prede_2297        CDS       T02403                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pdt  Prevotella dentalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Prede_2297
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Prede_2297
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Prede_2297
Enzymes [BR:pdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Prede_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1025295..1026620)
Genome map
AA seq 441 aa AA seqDB search
MKYYSTNHQAPEATLREAVERGLAPDRGLYMPERIERLPASFFDRIASMSFPDMAFEVSR
AFFGEDVDEASLRHIVADTLTFDTPVAPVDGNIFSLELFHGPTLAFKDVGARFMARLLQH
FIHRDAADGRPVNVLVATSGDTGSAVANGFLGVDGIHVYVLYPKGKVSRIQESQFTTLGR
NITALEVDGVFDDCQALVKSAFMDPELNAHMKLTSANSINVARFLPQAFYYFNAYAQLLR
DGRLRREGGRSNLVVCVPSGNFGNITAGLFGVRMGLPVKRFIAANNANDVFYNYLQSGQY
RPQPSKQTLANAMDVGDPSNFARILDLYGSSWPAIRADISGATYTDDRIRQTMRQCHERT
GYVLDPHGACGYQALREQLQPDELGVFLETAHPAKFKEQVDRILGTDIAIPERLQAFMRG
TRHSVPLPASFAAFKEYLMQQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactattccaccaaccaccaggcccccgaggccacgctgcgcgaggccgtggag
cgcggcctcgcccccgaccggggcctctacatgcccgagcgcatcgagcggctgccggcc
tcgttcttcgaccgcatcgcctccatgtcgttccccgacatggctttcgaggtgagccgc
gctttcttcggcgaagacgtggacgaggcctcgctgcgccacatcgtggccgacacgctg
acattcgacacgcccgtggcccccgtcgacggcaacatcttcagcctcgaactcttccac
ggccccacgctggccttcaaggacgtgggcgcccgctttatggcacggctgctacaacac
ttcatccaccgcgatgcagccgacggccgtcccgtgaacgtgctcgtggccacctcgggc
gacaccggatcggccgtggccaacggctttctcggcgtcgacggcatccacgtctacgtg
ctctatcccaagggcaaggtgagccgcatccaggaaagtcagttcaccacgctgggccgc
aacatcaccgccctcgaggtggacggcgtgttcgacgactgccaggccctggtgaagagc
gccttcatggaccccgaactcaacgcccacatgaagctcacctcggccaattccatcaac
gtggcccgtttcctgccccaggcgttctactatttcaacgcctacgcccagcttcttcgc
gacggccggctgcgtcgcgagggcggccgcagcaacctcgtggtgtgcgtgccgagcggc
aatttcggcaacatcacggccggcctcttcggcgtgcgcatgggactgcccgtgaagcgg
ttcatcgctgccaacaacgccaacgacgtcttctacaactatctgcagtcgggccagtac
cgtccgcagcccagcaagcagacgctggccaacgccatggacgtgggcgacccgagcaac
ttcgcccgcatactcgacctttacggctccagctggccggccatcagggccgacatcagc
ggggccacctacaccgacgaccgcatccgccagaccatgcgccagtgccacgagcgcacc
ggctacgtgctcgacccccacggagcctgcggctaccaggccttgcgcgagcagctgcag
cccgacgagctgggcgtgttcctcgaaacagcccatccggccaagttcaaggagcaggta
gaccgcatcctcggcaccgacatcgccatccccgaacgcctccaagccttcatgcgcggc
acccgccacagcgtgcccctgcccgccagcttcgccgccttcaaggagtatctgatgcag
cagtag

DBGET integrated database retrieval system