KEGG   Prevotella dentalis: Prede_2297Help
Entry
Prede_2297        CDS       T02403                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pdt  Prevotella dentalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Prede_2297
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Prede_2297
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Prede_2297
Enzymes [BR:pdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Prede_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1025295..1026620)
Genome map
AA seq 441 aa AA seqDB search
MKYYSTNHQAPEATLREAVERGLAPDRGLYMPERIERLPASFFDRIASMSFPDMAFEVSR
AFFGEDVDEASLRHIVADTLTFDTPVAPVDGNIFSLELFHGPTLAFKDVGARFMARLLQH
FIHRDAADGRPVNVLVATSGDTGSAVANGFLGVDGIHVYVLYPKGKVSRIQESQFTTLGR
NITALEVDGVFDDCQALVKSAFMDPELNAHMKLTSANSINVARFLPQAFYYFNAYAQLLR
DGRLRREGGRSNLVVCVPSGNFGNITAGLFGVRMGLPVKRFIAANNANDVFYNYLQSGQY
RPQPSKQTLANAMDVGDPSNFARILDLYGSSWPAIRADISGATYTDDRIRQTMRQCHERT
GYVLDPHGACGYQALREQLQPDELGVFLETAHPAKFKEQVDRILGTDIAIPERLQAFMRG
TRHSVPLPASFAAFKEYLMQQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactattccaccaaccaccaggcccccgaggccacgctgcgcgaggccgtggag
cgcggcctcgcccccgaccggggcctctacatgcccgagcgcatcgagcggctgccggcc
tcgttcttcgaccgcatcgcctccatgtcgttccccgacatggctttcgaggtgagccgc
gctttcttcggcgaagacgtggacgaggcctcgctgcgccacatcgtggccgacacgctg
acattcgacacgcccgtggcccccgtcgacggcaacatcttcagcctcgaactcttccac
ggccccacgctggccttcaaggacgtgggcgcccgctttatggcacggctgctacaacac
ttcatccaccgcgatgcagccgacggccgtcccgtgaacgtgctcgtggccacctcgggc
gacaccggatcggccgtggccaacggctttctcggcgtcgacggcatccacgtctacgtg
ctctatcccaagggcaaggtgagccgcatccaggaaagtcagttcaccacgctgggccgc
aacatcaccgccctcgaggtggacggcgtgttcgacgactgccaggccctggtgaagagc
gccttcatggaccccgaactcaacgcccacatgaagctcacctcggccaattccatcaac
gtggcccgtttcctgccccaggcgttctactatttcaacgcctacgcccagcttcttcgc
gacggccggctgcgtcgcgagggcggccgcagcaacctcgtggtgtgcgtgccgagcggc
aatttcggcaacatcacggccggcctcttcggcgtgcgcatgggactgcccgtgaagcgg
ttcatcgctgccaacaacgccaacgacgtcttctacaactatctgcagtcgggccagtac
cgtccgcagcccagcaagcagacgctggccaacgccatggacgtgggcgacccgagcaac
ttcgcccgcatactcgacctttacggctccagctggccggccatcagggccgacatcagc
ggggccacctacaccgacgaccgcatccgccagaccatgcgccagtgccacgagcgcacc
ggctacgtgctcgacccccacggagcctgcggctaccaggccttgcgcgagcagctgcag
cccgacgagctgggcgtgttcctcgaaacagcccatccggccaagttcaaggagcaggta
gaccgcatcctcggcaccgacatcgccatccccgaacgcctccaagccttcatgcgcggc
acccgccacagcgtgcccctgcccgccagcttcgccgccttcaaggagtatctgatgcag
cagtag

DBGET integrated database retrieval system