KEGG   Prevotella dentalis: Prede_2660Help
Entry
Prede_2660        CDS       T02403                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pdt  Prevotella dentalis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pdt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1362794..1363375)
Genome map
AA seq 193 aa AA seqDB search
MNPETEFRDGLDELAAHYRQVLALLGEDTQREGLLKTPMRVAKAMQVLTRGYTQDAHKVL
TDALFKEDYNQMVIVKDIDFYSMCEHHMLPFFGKTHVAYIPNGYITGLSKIARVVDIFSH
RLQVQERLTQQIKDCIQDTLKPLGVMVVVEAQHMCMQMRGVEKQNSITTTSDFSGAFNQA
KTREEFMNLLRQR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagaaacagagtttcgcgacgggctggacgagctcgccgcccattaccggcag
gtgctggccctcctgggagaggatacacagcgcgagggactgctcaagacgcccatgcgc
gtggccaaggccatgcaggtgctcacgcgcggttacacccaggacgcccacaaggtgctc
accgacgcactcttcaaggaggactataaccagatggttatcgtcaaggacatcgacttc
tactcgatgtgcgaacaccacatgctgcccttcttcggcaagacacacgtggcctatatc
cccaacggatacatcaccggactgagcaaaatagcacgcgtggtcgatattttcagccac
cgcctacaggtacaggaacggctcacacagcaaatcaaggactgcattcaggacacgctg
aagcccctcggcgtgatggtggtggtcgaggcacagcacatgtgcatgcagatgcggggc
gtggagaagcagaattccatcaccacaacctccgacttcagcggcgcattcaaccaggcc
aagacgcgagaggagttcatgaacctgctccgtcaaagatag

DBGET integrated database retrieval system