KEGG   Pseudonocardia dioxanivorans: Psed_0354Help
Entry
Psed_0354         CDS       T01479                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pdx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
399200..399817
Genome map
AA seq 205 aa AA seqDB search
MFEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAADPADVSRLQEVLQRVKQGVRFCEVCS
NVSENERCRFCTDARRDPTVVCVVEEPKDVLAVERTREFKGRYHVLGGALDPLGGIGPDS
LKIRELLARLGGTGPASDETEIAEVIIATDPNTEGEATATYLVRLLRDFPGLTVSRPAAG
LPMGGDLEFADELTLGRALSGRRAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagggaccggtccaggacctgatcgacgagctgggccggctgccgggcgtcggg
cccaagagtgcgcagcggatcgcgttccacctgctggcggccgacccggccgacgtctcc
cggctgcaggaggtgctccagcgggtcaagcagggtgtgcggttctgcgaggtctgcagc
aacgtctcggagaacgaacgctgccgcttctgcaccgacgcgcggcgggacccgacggtg
gtgtgcgtcgtcgaggagcccaaggacgtcctcgccgtggaacgcacccgcgagttcaag
ggccgctaccacgtcctgggcggggcgctggatccgttggggggcatcggccccgactcg
ctgaagatccgagagctgctcgcccggctcggcgggacgggcccggcgtccgacgagacc
gagatcgccgaggtcatcatcgcgaccgaccccaacaccgagggggaggcgacggccacg
tacctggtccggctgctgcgcgacttccccgggctgacggtgtcgcggcccgcggcgggg
ctgccgatgggcggcgacctggagttcgccgacgagctcacgctcggacgggcgctctcc
ggccgccgcgcactctga

DBGET integrated database retrieval system