KEGG   Pseudonocardia dioxanivorans: Psed_0354Help
Entry
Psed_0354         CDS       T01479                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psed_0354
DNA repair and recombination proteins [BR:pdx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Psed_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
399200..399817
Genome map
AA seq 205 aa AA seqDB search
MFEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAADPADVSRLQEVLQRVKQGVRFCEVCS
NVSENERCRFCTDARRDPTVVCVVEEPKDVLAVERTREFKGRYHVLGGALDPLGGIGPDS
LKIRELLARLGGTGPASDETEIAEVIIATDPNTEGEATATYLVRLLRDFPGLTVSRPAAG
LPMGGDLEFADELTLGRALSGRRAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagggaccggtccaggacctgatcgacgagctgggccggctgccgggcgtcggg
cccaagagtgcgcagcggatcgcgttccacctgctggcggccgacccggccgacgtctcc
cggctgcaggaggtgctccagcgggtcaagcagggtgtgcggttctgcgaggtctgcagc
aacgtctcggagaacgaacgctgccgcttctgcaccgacgcgcggcgggacccgacggtg
gtgtgcgtcgtcgaggagcccaaggacgtcctcgccgtggaacgcacccgcgagttcaag
ggccgctaccacgtcctgggcggggcgctggatccgttggggggcatcggccccgactcg
ctgaagatccgagagctgctcgcccggctcggcgggacgggcccggcgtccgacgagacc
gagatcgccgaggtcatcatcgcgaccgaccccaacaccgagggggaggcgacggccacg
tacctggtccggctgctgcgcgacttccccgggctgacggtgtcgcggcccgcggcgggg
ctgccgatgggcggcgacctggagttcgccgacgagctcacgctcggacgggcgctctcc
ggccgccgcgcactctga

DBGET integrated database retrieval system