KEGG   Pseudonocardia dioxanivorans: Psed_0407Help
Entry
Psed_0407         CDS       T01479                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00010  Glycolysis / Gluconeogenesis
pdx00620  Pyruvate metabolism
pdx00640  Propanoate metabolism
pdx00680  Methane metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_0407
   00620 Pyruvate metabolism
    Psed_0407
   00640 Propanoate metabolism
    Psed_0407
  Energy metabolism
   00680 Methane metabolism
    Psed_0407
Enzymes [BR:pdx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psed_0407
Lipid biosynthesis proteins [BR:pdx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psed_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEA22679
JGI: Psed_0407
UniProt: F4CIT4
Position
449345..451321
Genome map
AA seq 658 aa AA seqDB search
MAESGATLSNLSHEDRTFPPSEEFAAQANATAEWYDRADADREAFWAEQADRLTWSKKWD
SVLEWDAPFAKWFVGGQLNVAYNCVDRHVEDGHGDQVAFHWEGEPGDTRTITYADLQREV
CRTANALTELGVGKGDRVAIQLPMIPEAAFAMLACARLGALHSVVFGGFSPSALRSRIED
AEAKLLITSDGQYRRGKPAPMKENTDQAVADTPTIEHVLVVKRTETDVPWTEGRDVWWHD
IVDRQPDTHEYESFDSEHPLYILYTSGTTGKPKGILHTSGGYLTQAAYTHHVVFDHKPGE
SVYWCTADIGWVTGHSYIVYGPLANRATSVMYEGTPNTPHEGRHWEIVQKYGVTIYYTAP
TLIRTFMKWGKEIPEKYDLSSLRVLGSVGEPINPEAWIWYRENVGRNNCPIVDTWWQTET
GAIMISPLPGVTAAKPGSAMRPLPGISAEVVTEEAEPVGPGGGGYLVLDKPWPAMLRGIW
GDEERYRETYWSRFAKQGYYFAGDGAKYDDDGAIWLLGRVDDVMNVSGHRISTTEVESAL
VSHPTVAEAAVVGASDPTTGQGIVAFVILRGGVAQDEAKGADAIKALRDHVSKEIGPIAK
PRQIMVVEELPKTRSGKIMRRLLRDVAENREVGDVTTLADSSVMDLISAGLQEGKGDD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccggcgccacgttgagcaacctttcccacgaggaccgcaccttcccgccg
agcgaggagttcgccgcccaggcgaatgcgacggcggagtggtacgaccgggccgacgcg
gaccgcgaggccttctgggcggagcaggccgaccggctgacgtggtcgaagaagtgggac
tccgtcctggagtgggacgccccgttcgcgaagtggttcgtcggcggacagctcaacgtc
gcctacaactgcgtcgaccggcacgtcgaggacggtcacggcgaccaggtcgcgttccat
tgggagggcgagccgggcgacacccgcacgatcacctacgcggacctgcagcgcgaggtc
tgcaggacggccaacgcgctcaccgagctgggcgtgggcaagggcgaccgggtcgcgatc
cagctgccgatgatccccgaggccgcgttcgcgatgctggcctgcgcgcggctgggcgcg
ctgcacagcgtcgtcttcggcgggttctcgccgagcgcgctgcgctcgcgcatcgaggac
gccgaggcgaagctgctcatcacctccgacggccagtaccgccgcggcaagccggcgccg
atgaaggagaacaccgaccaggcggtcgccgacaccccgacgatcgagcacgtgctcgtc
gtgaagcggaccgagaccgacgtgccgtggaccgagggccgcgacgtgtggtggcacgac
atcgtcgaccggcagcccgacacccacgagtacgagtcgttcgactccgagcacccgctc
tacatcctctacacgtcggggacgacggggaagccgaagggcatcctgcacacctcgggc
ggctacctcacccaggcggcctacacccaccacgtcgtgttcgaccacaagccgggcgag
agcgtgtactggtgcacggccgacatcggctgggtgaccgggcacagctacatcgtctac
gggccgctggccaaccgggcgacgtcggtgatgtacgagggcacgccgaacaccccgcac
gagggccggcactgggagatcgtgcagaagtacggcgtcacgatctactacaccgcgccc
acgttgatccgcacgttcatgaagtggggcaaggagatcccggagaagtacgacctctcc
tcgctcagggtgctgggcagcgtcggcgagccgatcaaccccgaggcctggatctggtac
cgggagaacgtgggccgcaacaattgcccgatcgtcgacacctggtggcagaccgagacc
ggggcgatcatgatctcgccgctcccgggcgtcaccgcggcgaagccgggctcggcgatg
cgcccgctgccgggcatcagcgccgaggtcgtcaccgaggaggccgagccggtcgggccc
ggcggcggtgggtacctggtgctcgacaagccgtggccggcgatgctgcgcggcatctgg
ggcgacgaggagcgctaccgcgagacctactggtcgcggttcgcgaagcagggctactac
ttcgcgggcgacggcgcgaagtacgacgacgacggcgcgatctggctgctcggccgcgtc
gacgacgtcatgaacgtctccggacaccgcatctcgacgacggaggtcgagtccgcgctg
gtctcccacccgacggtggcggaggcggcggtcgtcggtgcgtcggacccgacgacgggc
cagggcatcgtcgcgttcgtcatcctgcgcggcggggtcgcccaggacgaggcgaagggg
gccgacgccatcaaggcgctgcgcgaccacgtgtccaaggagatcgggccgatcgccaag
ccgcgccagatcatggtcgtcgaggagctgcccaagacccggtccggcaagatcatgcgt
aggctgctgcgtgacgtggcggagaatcgtgaggtcggcgacgtcacgacgctcgcggac
tcgtcggtcatggacctgatctcggccggcctgcaggaaggaaagggcgacgactga

DBGET integrated database retrieval system