KEGG   Pseudonocardia dioxanivorans: Psed_0798Help
Entry
Psed_0798         CDS       T01479                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00040  Pentose and glucuronate interconversions
pdx00052  Galactose metabolism
pdx00500  Starch and sucrose metabolism
pdx00520  Amino sugar and nucleotide sugar metabolism
pdx01100  Metabolic pathways
pdx01130  Biosynthesis of antibiotics
Module
pdx_M00362  Nucleotide sugar biosynthesis, prokaryotes
pdx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Psed_0798
   00052 Galactose metabolism
    Psed_0798
   00500 Starch and sucrose metabolism
    Psed_0798
   00520 Amino sugar and nucleotide sugar metabolism
    Psed_0798
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Psed_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: AEA23055
JGI: Psed_0798
UniProt: F4CP19
Position
848403..849299
Genome map
AA seq 298 aa AA seqDB search
MSESSARRSFRSAVVPAAGLGTRFLPTTKTVPKELLPVVDTPGIELVAEEAAQAGAERLL
IVTSPGKDAVAAHFAPQPALEEMLKERGKDALLAKVRRAPDLLEVATVTQHEPKGLGHAV
GCVADVLDDDEEAVAVLLPDDLVLPTGVLTRMAQVRDQHGGTVLCAFDIPGPEISAYGVF
DVADTADADVKRVHGMVEKPPADEAPSTYAAAGRYLLDRAIFDALGRITPGAGGELQLTD
AVALLIEEGHPVHVVVHRGGRHDLGNPGGYVRAFVDFALQHPDYGDDLRSWLAARLEG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtccagcgcgcgccggtccttccgctccgccgtggtgcccgccgccggtctg
gggacccggttcctgccgacgacgaagaccgtgcccaaggagctgctgccggtcgtcgac
acgccggggatcgagctggtcgcggaggaggccgcccaggccggggccgagcgcctgctc
atcgtcacctcgccgggcaaggacgccgtcgccgcgcacttcgcgccgcaacccgcgctg
gaggagatgctcaaggaacgcggcaaggacgcgctgctggccaaggtccggcgggcgccc
gacctgctcgaggtcgccaccgtcacccagcacgagcccaagggcctcgggcacgccgtc
ggctgcgtggccgacgtgctggacgacgacgaggaggccgtcgcggtcctgctccccgac
gacctcgtgctccccaccggcgtgctcacccggatggcgcaggtccgggaccagcacggc
gggaccgtgctgtgcgccttcgacatccccgggcccgagatctcggcctacggcgtcttc
gacgtcgccgacaccgccgacgccgacgtcaagcgcgtgcacgggatggtcgagaagccc
cccgccgacgaggcgccctcgacctacgcagcggccggccggtacctgctcgaccgggcg
atcttcgacgcgctcggtcggatcacgccgggcgcgggcggcgagctgcagctcaccgac
gccgtcgccctgctgatcgaggaggggcacccggtgcacgtcgtcgtccaccgcggtggc
cgtcacgacctcggcaacccgggcggctacgtcagggcgttcgtggacttcgcgctgcag
catcccgactacggcgacgacctgcgcagctggctcgctgcgcggctggagggttag

DBGET integrated database retrieval system