KEGG   Pseudonocardia dioxanivorans: Psed_0839Help
Entry
Psed_0839         CDS       T01479                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psed_0839
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Psed_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
890328..891299
Genome map
AA seq 323 aa AA seqDB search
MLAAVPSPVTVRVPGKINLHLAVGDVRDDGFHELVTVFHAVSLFDEVTVTASESPGIEVL
GDSAAEVPADGTNLAWRAVELLGRHVEHDTDVRVVLRKGIPVAGGMAGGSADAAGTLVAL
AALWKLDLTRDELAVLAADLGSDVTFALHGGTALGTGRGERIVPVLARHPQHWVIALHRQ
GLSTPTVFGELDRLRAASSDPTPVRAVEPVLEALAGGDPRQLALSLGNDLQAAAVSLAPD
LRRTLRAGVSAGALAGLVSGSGPSCAFLCDSADSAVEVAAELAGAGVCRTVRVAHGPVPG
ARVVDENEPPSGPPTGSWPKVRA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgccgtcccctccccggtcaccgtgcgtgtgccggggaagatcaacctgcat
ctcgccgtcggcgacgtgcgtgacgacggtttccacgagctggtcaccgtcttccacgcg
gtgagcctgttcgacgaggtcacggtcaccgcctcggagtcgccggggatcgaggtcctc
ggggactcggcggccgaggtcccggccgacggcaccaacctcgcgtggcgggccgtcgag
ctgctgggccgccacgtcgagcacgacaccgacgtccgggtggtgctgcgcaagggcatc
ccggtcgcgggcggcatggcgggcggcagcgccgacgcggcgggcacgctcgtcgcgctc
gcggcgctctggaagctcgacctcacccgcgacgagctggccgtcctggccgcagacctg
ggcagcgacgtgacgttcgcgctgcacggcggcaccgcgctgggcaccgggcggggggag
cggatcgtgcccgtgctcgcgcgacacccgcagcactgggtgatcgcgctgcaccggcag
gggctgtcgacaccgaccgtcttcggtgagctcgaccggctgcgggccgcgtcgtcggac
ccgacgccggtgcgcgccgtcgagccggtgctggaggcgctcgcgggcggcgacccgcga
cagctcgccctctccctgggcaacgacctgcaggcggcggccgtcagcctggcacccgac
ctgcgccggaccctgcgcgcgggggtctcggcgggcgcgctcgcggggctggtcagcggg
tccggccccagctgcgcgttcctgtgcgacagcgccgactccgccgtcgaggtcgccgcc
gagctggcgggcgcgggcgtgtgccgcacggtccgcgtcgcgcacggcccggtgcccggc
gcgcgggtcgtcgacgagaacgagccgccgtcgggccccccgaccggctcctggccgaaa
gtgcgtgcctga

DBGET integrated database retrieval system