KEGG   Pseudonocardia dioxanivorans: Psed_1133Help
Entry
Psed_1133         CDS       T01479                                 

Definition
(GenBank) putative kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00230  Purine metabolism
pdx01100  Metabolic pathways
Module
pdx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Psed_1133
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Psed_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 CPT
Motif
Other DBs
NCBI-ProteinID: AEA23384
JGI: Psed_1133
UniProt: F4CSH9
Position
1200617..1201171
Genome map
AA seq 184 aa AA seqDB search
MASTSLGVILYGPPASGKDTVTGALRRLNPRYELFRRLKVGGGRTAGYRLTDQATIDALR
EQGEIIWENQRYDALYAIDRQTLVEYLDRGVPVVHAGQPEVIDAVVAAIPGAHWLVVALS
CPREVAEQRIIARATGDTTERLWLWDRTPVLMQPVVAIDTSLYCPDAAAELINGQATVHV
AKAR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcaacgtcgctcggagtcatcctctacggcccgccggcgtctgggaaggacacc
gtcactggagcgctgcgccgtcttaaccctcgctacgagctgttccgcaggctcaaggta
ggcggtggacgtaccgcgggctatcgcctcaccgaccaggccacgatcgatgccttacgt
gagcaaggcgaaataatctgggagaatcagcgttacgacgcgctctacgctattgatcgg
caaacgctcgttgagtacttagaccgaggcgtgccagtcgtgcatgccggccagccggag
gtcatcgatgctgtggttgccgccatacccggtgcccactggctcgtcgttgcgctatct
tgtccgcgcgaagtcgccgaacagcgcatcatcgcacgtgcgacaggcgacacgaccgag
cggttgtggctttgggatcggacgcccgtgctcatgcagccagtggtcgcgattgacacc
agcctctactgcccggatgcagccgctgagctgatcaacggtcaggcgacggttcatgtg
gcgaaggcgcggtag

DBGET integrated database retrieval system