KEGG   Pseudonocardia dioxanivorans: Psed_1495Help
Entry
Psed_1495         CDS       T01479                                 

Definition
cytochrome c oxidase subunit I
Orthology
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Psed_1495
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Psed_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1568954..1570708
Genome map
AA seq 584 aa AA seqDB search
MTAVAPKPITTRPYPARRSAKGSTLLKMMRTTDPKDIAILYLVTSFGFFLAGGAMALLMR
AELARPGLQFLSPEQYNQLFTMHGTIMLLLYATPILFGFANYIVPLQIGAPDVAFPRLNA
FSYWLFLFGGLTAMAGFLTPGGAADFGWFAYSPLSDAVHSPGAGADLWIMGLAVAGLGTI
LGGVNFITTIVCLRAPGMTMFRMPIFTWNIFVTAILILIAFPVLTAALLGLAADRHLGAH
VFDPANGGAILWQHMFWFFGHPEVYIVALPFFGIVSEIFPVFSRKPVFGYKGLIYATISI
AALSVAVWAHHMYATGAVLLAFFSFTTFLIAIPTGVKFVNWIGTMWKGKLTFETPMLFSV
GFLATFLFGGLTGILLASPPLDFHVSDSYFVVAHFHYVLFGTIVFATYAGIYFWFPKMTG
RMMDETLGKVHFWLTFFGFHTTFLVQHWLGNEGMPRRYADYLPTDGFTTLNTVSSIGAFV
LGASTLPFIWNVFRSYRYGRVVTVDDPWGFGNSLEWATSCPPPRHNFTELPRIRSERPAF
ELHYPHLVEQFRREAHAGGHASPYEMAASATGQEVMSGDDPKDR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgacagccgtcgcgcccaagccgatcacgacgcgcccgtacccggcgcgccgctcggcc
aagggatccacgctgctcaagatgatgcggacgacggaccccaaggacatcgcgatcctg
tacctggtcacatcgttcggcttcttcctggccggcggtgcgatggcgctgctgatgcgc
gccgagctggcccgtcccgggctgcagttcctctcgcccgagcagtacaaccagctgttc
acgatgcacggcacgatcatgctgctgctgtacgcgacgccgatcctgttcggcttcgcc
aactacatcgtgccgctgcagatcggggcccccgacgtcgcgttcccgcggctgaacgcc
ttctcctactggctgttcctgttcggcggcctcacggcgatggcaggcttcctcacgccg
ggtggcgcggccgacttcgggtggttcgcctactcgccgctgtcggacgccgtgcactcg
cccggcgcgggcgccgacctgtggatcatgggtctggcggtcgccggtctcgggacgatc
ctcggtggcgtcaacttcatcacgacgatcgtctgcctgcgcgcgcccggtatgacgatg
ttccggatgccgatcttcacgtggaacatcttcgtgacggccatcctgatcctcatcgcg
ttcccggtgctcaccgccgcgctgctcggcctggccgccgaccggcacctcggggcgcac
gtgttcgacccggccaacggcggggcgatcctgtggcagcacatgttctggttcttcggc
catcccgaggtctacatcgtcgcgctgccgttcttcgggatcgtctcggagatcttcccg
gtgttcagccgcaagccggtgttcggctacaagggcctgatctacgcgacgatctccatc
gcggccctgtcggtcgcggtgtgggcgcaccacatgtacgccaccggcgcggtgctgctg
gcgttcttctccttcacgacgttcctcatcgcgatcccgacgggtgtcaagttcgtcaac
tggatcggcacgatgtggaagggcaagctgacgttcgagacgccgatgttgttctccgtc
ggcttcctggcgacgttcctgttcggtggtctgacgggcatcctgctggcctcgccgccg
ctggacttccacgtgtccgacagctacttcgtggtggcgcacttccactacgtgctgttc
gggacgatcgtgttcgccacctatgccgggatctacttctggttcccgaagatgaccggc
cggatgatggacgagacgctgggcaaggtccatttctggttgacgttcttcgggttccac
acgacgttcctggtgcagcactggctgggcaacgagggcatgccgcgccgctacgcggac
tatctgccgaccgacgggttcaccacgctgaacacggtctcctcgatcggcgcgttcgtc
ctgggggcctcgacgctgccgttcatctggaacgtgttccgttcctaccggtacgggcgt
gtggtgaccgtcgacgacccgtggggtttcgggaactcgctggagtgggccacgtcgtgc
ccgccgccgcggcacaacttcaccgagctgccgcggatccggtccgagcggccggcgttc
gagctgcactatccgcacctggtcgagcagttccgacgcgaggcgcacgcgggcggtcat
gcgtcgccgtacgagatggcggcatcggcgacgggtcaggaagtgatgtcgggcgacgac
ccgaaggaccgttga

DBGET integrated database retrieval system