KEGG   Pseudonocardia dioxanivorans: Psed_1584Help
Entry
Psed_1584         CDS       T01479                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_1584
   01230 Biosynthesis of amino acids
    Psed_1584
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_1584
   00030 Pentose phosphate pathway
    Psed_1584
   00051 Fructose and mannose metabolism
    Psed_1584
   00052 Galactose metabolism
    Psed_1584
  Energy metabolism
   00680 Methane metabolism
    Psed_1584
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Psed_1584
Protein phosphatases and associated proteins [BR:pdx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Psed_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1659895..1661268
Genome map
AA seq 457 aa AA seqDB search
MSEAAPHLDLVGPPPTSAGTAPDLSIETLGPGRIVSPLEPLLHARRTSEHYVDEDDRVLL
DDTVAGIAARGGRLEDLPGMEPCGPRRSIFFDPSKTRAGIVTCGGLCPGLNDVIAGLVRS
LTYHYKVRRVIGFRNGYQGFVPAYGHDVVELTPDSVRDIPVDGGTVLGTSRGHQDPEEIV
DCLENTHVNVLFVVGGDGSMRGAMEIARVVRERGLRIAVVGIPKTIDNDIPYIDQSFGFQ
TAFVLASDAIRAARVEAKSTANGVGLVKLMGRHSGFIACYAALARSDADVVLIPEVPFAL
EGDGGLLAHVRRRVAERGHAVVVVAEGAGQDLVATGPTVADASGNARLTDIGPYLRRRIV
DDFEAAGIETAVRYIDPSYAIRSVPANPYDSVYCTRLSQAAVHAAMSGRTAMVVGRYRRR
FVHIPMRLAVSRRNQVDPHGDLWMSVLESTGQPPQLA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccgccccccacctcgacctggtcggaccacccccgacgagcgccgggacc
gcacccgacctctcgatcgagaccctcggccccggccgcatcgtctcgccgctggagcca
ctgctgcacgcccgccggaccagcgagcactacgtcgacgaggacgaccgcgtcctgctc
gacgacaccgtcgcgggcatcgccgcgcgcggcggccggctcgaggacctaccggggatg
gaaccgtgcgggccgcggcggagcatcttcttcgacccgtcgaagacccgtgccgggatc
gtgacctgcggcggcctgtgccccgggctcaacgacgtcatcgcgggcctcgtccgcagt
ctcacgtaccactacaaggtgcggcgggtgatcggcttccgcaacggctaccaggggttc
gtccccgcctacggccacgacgtcgtcgagctgaccccggactccgtgcgcgacatcccc
gtcgacgggggcaccgtcctcggcacctcacgcggccaccaggacccggaggagatcgtc
gactgcctggagaacacgcacgtcaacgtcctgttcgtcgtcggcggggacgggtcgatg
cgcggcgccatggagatcgcgcgcgtcgtgcgggagcgagggctgcggatcgccgtcgtc
ggcatcccgaagacgatcgacaacgacatcccctacatcgaccagagcttcggcttccag
acggcgttcgtgctggcgagcgacgccatccgggcggcgcgggtcgaggcgaagtcgacg
gccaacggcgtcgggctggtcaagctgatgggccggcactcgggcttcatcgcctgctat
gcggcgctggcccgcagcgacgccgacgtcgtgctgatccccgaggtgccgttcgcgctc
gagggcgacggcgggctgctcgcccacgtccggcggcgcgtcgccgagcgcgggcacgcc
gtcgtcgtcgtggcggagggtgcgggtcaggacctggtggcgaccggcccgaccgtcgcc
gacgcgtccggcaacgcccggctcaccgacatcggcccgtacctgcgccggcggatcgtc
gacgacttcgaggccgcgggcatcgagaccgccgtccgctacatcgacccgagctacgcc
atccgcagcgtgccggccaacccctacgacagcgtctactgcacccggctctcgcaggcg
gccgtacacgcggcgatgtcgggccggacggcgatggtcgtcggacggtaccggcgccgg
ttcgtgcacatcccgatgcggctcgcggtgagcaggcgcaatcaggtggacccgcacggt
gacctgtggatgtccgtcctggagtcgacgggccagcccccgcagctggcctga

DBGET integrated database retrieval system