KEGG   Pseudonocardia dioxanivorans: Psed_1622Help
Entry
Psed_1622         CDS       T01479                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pdx00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1704772..1705755
Genome map
AA seq 327 aa AA seqDB search
MSGLVRTTALPWAELARFPLAAGPTPLVRAHRLEAALGIGPLLVKRDDLIGFGVAGNKTR
PLEFLVGAAVQQGARVFVTGGGPGSNFCAAAAMAARAAGLACELHVWGDPRSANLALATA
AGATLVPTGGSVREEVDEQVMARVAQLGASAYGVPRGGSTALGAVGFAAGAAEVAAQLAA
ADVRPGLIVLPVGSGGSVAGLLTGLAAVGLDVPVLGVSVSRPLDEIRAKVLELAAGCAAL
LGCAAPDPGALTLVDARGPGFGTASERERAHAREALWAEGLLLDETYGAEAFSAVVDLVD
PPADGPVLWWHTGGLLPAVGSLLKGPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcctcgtgaggaccaccgcgctgccgtgggccgagctcgcccggttcccgctg
gcggccggaccgacgccgctggtgcgtgcgcaccggctggaggccgcgctcggcatcggc
ccgctgctggtcaagcgcgacgacctgatcggcttcggcgtggcgggcaacaagacccgg
ccgctggagttcctcgtcggcgccgcggtgcagcagggcgcgcgggtgttcgtcaccggc
ggcgggcccggttccaacttctgcgccgcggccgcgatggccgcgcgcgccgcggggctg
gcctgcgagctgcacgtctggggcgatccgcggtcggcgaacctcgcgctcgcgacggcc
gccggcgccaccctggtgccgaccggcggcagcgtccgcgaggaggtcgacgagcaggtc
atggcccgggtcgcccagctcggcgcgagtgcctacggcgtcccgcgcgggggctccacg
gcgctgggcgccgtcgggttcgccgcgggcgcggccgaggtcgccgcccagctcgccgcc
gcggacgtccggcccgggctgatcgtgctgcccgtcggctccggcggcagcgtcgcgggc
ctgctcaccggactggccgccgtcgggctcgacgtgccggtgctcggcgtgtcggtgagc
cgcccgttggacgagatccgggccaaggtgctcgagctcgccgcgggctgcgccgcgctg
ctgggctgcgccgcacccgatccgggcgcactgacgctggtcgacgcccgcggccccggc
ttcggcacggcgagcgagcgcgagcgcgcccacgcccgcgaggcgctgtgggccgagggc
ctgctgctcgacgagacgtacggggccgaggccttctccgcggtggtcgacctggtcgac
ccacccgccgacggcccggtcctgtggtggcacaccggcgggctgctgcccgccgtcggc
tccctgctgaaaggaccagcatga

DBGET integrated database retrieval system