KEGG   Pseudonocardia dioxanivorans: Psed_1665Help
Entry
Psed_1665         CDS       T01479                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psed_1665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_1665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psed_1665
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psed_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754510..1755598
Genome map
AA seq 362 aa AA seqDB search
MSAATPSRTGAVRWPGVIEAYRNRMPVQDDWTIVTLGEGGTPLLPAPVLSELTGCEVHLK
VDGANPTGSFKDRGMTMAVTAALAEGKQSVLCASTGNTSASAAAYATRAGMTCAVLVPRG
KIALGKLAQAVAHGARILQIDGNFDDCLELARKTTSDYPSIALVNSVNPTRIAGQASAAY
EICDDLGRAPDVHCLPVGNAGNITAYWKGFRAYHADGVIPELPRMFGFQAAGAAPLVHGA
PVKNPETIATAIRIGAPASWGTAVAARDESGGLFAAVTDDEILAAYRLLSAREAVFVEPA
SAASVAGLLKSSAGGTLPRGSLVVCTVTGHGLKDPDTALLTAPDPEIVPIDPAAVAAALE
LA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgacgccgtcgcggaccggggcggtgcgctggcccggtgtgatcgaggcc
taccgcaaccggatgccggtccaggacgactggacgatcgtcaccctcggcgagggcggc
acgccgctgctgcccgcgccggtcctctcggagctcaccggctgcgaggtgcacctcaag
gtcgacggcgccaacccgacggggtcgttcaaggaccgcggcatgacgatggccgtcacc
gccgcgctcgccgagggcaagcagagcgtgctgtgcgcgtcgacgggcaacacctcggcg
tcggccgcggcctacgccacgcgggcgggcatgacgtgcgcggtgctcgtcccccgcggc
aagatcgcgctgggcaagctcgcccaggccgtcgcgcacggtgcgcggatcctgcagatc
gacgggaacttcgacgactgcctcgagctcgcccgcaagacgacgtcggactacccgtcg
atcgcgctggtgaactccgtcaacccgacgcggatcgccggccaggccagcgccgcctac
gagatctgcgacgacctgggccgcgcgcccgacgtgcactgcctgcccgtcggcaacgcc
ggcaacatcaccgcctactggaagggtttccgcgcctaccacgccgacggggtcatcccg
gagctgccgcgcatgttcggcttccaggccgcgggcgccgcgcctctcgtccacggtgcg
ccggtgaagaaccccgagacgatcgcgacggccatccgcatcggcgccccggcgtcgtgg
gggaccgccgtcgccgcacgcgacgagtcgggcgggctgttcgccgccgtcaccgacgac
gagatcctcgccgcgtaccggctgctgtcggcccgcgaggcggtgttcgtcgagcccgcg
tcggcggccagcgtcgcgggcctgctcaagtcgtcggccggggggacgctgccgcgcggc
tcgctcgtcgtgtgcaccgtcaccgggcacgggctcaaggaccccgacaccgcgctgctc
accgcgccggacccggagatcgtcccgatcgaccccgcggccgtcgcggccgctctggag
ctggcctga

DBGET integrated database retrieval system