KEGG   Pseudonocardia dioxanivorans: Psed_1665Help
Entry
Psed_1665         CDS       T01479                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psed_1665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_1665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psed_1665
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psed_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754510..1755598
Genome map
AA seq 362 aa AA seqDB search
MSAATPSRTGAVRWPGVIEAYRNRMPVQDDWTIVTLGEGGTPLLPAPVLSELTGCEVHLK
VDGANPTGSFKDRGMTMAVTAALAEGKQSVLCASTGNTSASAAAYATRAGMTCAVLVPRG
KIALGKLAQAVAHGARILQIDGNFDDCLELARKTTSDYPSIALVNSVNPTRIAGQASAAY
EICDDLGRAPDVHCLPVGNAGNITAYWKGFRAYHADGVIPELPRMFGFQAAGAAPLVHGA
PVKNPETIATAIRIGAPASWGTAVAARDESGGLFAAVTDDEILAAYRLLSAREAVFVEPA
SAASVAGLLKSSAGGTLPRGSLVVCTVTGHGLKDPDTALLTAPDPEIVPIDPAAVAAALE
LA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgacgccgtcgcggaccggggcggtgcgctggcccggtgtgatcgaggcc
taccgcaaccggatgccggtccaggacgactggacgatcgtcaccctcggcgagggcggc
acgccgctgctgcccgcgccggtcctctcggagctcaccggctgcgaggtgcacctcaag
gtcgacggcgccaacccgacggggtcgttcaaggaccgcggcatgacgatggccgtcacc
gccgcgctcgccgagggcaagcagagcgtgctgtgcgcgtcgacgggcaacacctcggcg
tcggccgcggcctacgccacgcgggcgggcatgacgtgcgcggtgctcgtcccccgcggc
aagatcgcgctgggcaagctcgcccaggccgtcgcgcacggtgcgcggatcctgcagatc
gacgggaacttcgacgactgcctcgagctcgcccgcaagacgacgtcggactacccgtcg
atcgcgctggtgaactccgtcaacccgacgcggatcgccggccaggccagcgccgcctac
gagatctgcgacgacctgggccgcgcgcccgacgtgcactgcctgcccgtcggcaacgcc
ggcaacatcaccgcctactggaagggtttccgcgcctaccacgccgacggggtcatcccg
gagctgccgcgcatgttcggcttccaggccgcgggcgccgcgcctctcgtccacggtgcg
ccggtgaagaaccccgagacgatcgcgacggccatccgcatcggcgccccggcgtcgtgg
gggaccgccgtcgccgcacgcgacgagtcgggcgggctgttcgccgccgtcaccgacgac
gagatcctcgccgcgtaccggctgctgtcggcccgcgaggcggtgttcgtcgagcccgcg
tcggcggccagcgtcgcgggcctgctcaagtcgtcggccggggggacgctgccgcgcggc
tcgctcgtcgtgtgcaccgtcaccgggcacgggctcaaggaccccgacaccgcgctgctc
accgcgccggacccggagatcgtcccgatcgaccccgcggccgtcgcggccgctctggag
ctggcctga

DBGET integrated database retrieval system