KEGG   Pseudonocardia dioxanivorans: Psed_1665Help
Entry
Psed_1665         CDS       T01479                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00260  Glycine, serine and threonine metabolism
pdx00750  Vitamin B6 metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01230  Biosynthesis of amino acids
Module
pdx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_1665
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psed_1665
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psed_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEA23901
JGI: Psed_1665
UniProt: F4CJ51
Position
1754510..1755598
Genome map
AA seq 362 aa AA seqDB search
MSAATPSRTGAVRWPGVIEAYRNRMPVQDDWTIVTLGEGGTPLLPAPVLSELTGCEVHLK
VDGANPTGSFKDRGMTMAVTAALAEGKQSVLCASTGNTSASAAAYATRAGMTCAVLVPRG
KIALGKLAQAVAHGARILQIDGNFDDCLELARKTTSDYPSIALVNSVNPTRIAGQASAAY
EICDDLGRAPDVHCLPVGNAGNITAYWKGFRAYHADGVIPELPRMFGFQAAGAAPLVHGA
PVKNPETIATAIRIGAPASWGTAVAARDESGGLFAAVTDDEILAAYRLLSAREAVFVEPA
SAASVAGLLKSSAGGTLPRGSLVVCTVTGHGLKDPDTALLTAPDPEIVPIDPAAVAAALE
LA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgacgccgtcgcggaccggggcggtgcgctggcccggtgtgatcgaggcc
taccgcaaccggatgccggtccaggacgactggacgatcgtcaccctcggcgagggcggc
acgccgctgctgcccgcgccggtcctctcggagctcaccggctgcgaggtgcacctcaag
gtcgacggcgccaacccgacggggtcgttcaaggaccgcggcatgacgatggccgtcacc
gccgcgctcgccgagggcaagcagagcgtgctgtgcgcgtcgacgggcaacacctcggcg
tcggccgcggcctacgccacgcgggcgggcatgacgtgcgcggtgctcgtcccccgcggc
aagatcgcgctgggcaagctcgcccaggccgtcgcgcacggtgcgcggatcctgcagatc
gacgggaacttcgacgactgcctcgagctcgcccgcaagacgacgtcggactacccgtcg
atcgcgctggtgaactccgtcaacccgacgcggatcgccggccaggccagcgccgcctac
gagatctgcgacgacctgggccgcgcgcccgacgtgcactgcctgcccgtcggcaacgcc
ggcaacatcaccgcctactggaagggtttccgcgcctaccacgccgacggggtcatcccg
gagctgccgcgcatgttcggcttccaggccgcgggcgccgcgcctctcgtccacggtgcg
ccggtgaagaaccccgagacgatcgcgacggccatccgcatcggcgccccggcgtcgtgg
gggaccgccgtcgccgcacgcgacgagtcgggcgggctgttcgccgccgtcaccgacgac
gagatcctcgccgcgtaccggctgctgtcggcccgcgaggcggtgttcgtcgagcccgcg
tcggcggccagcgtcgcgggcctgctcaagtcgtcggccggggggacgctgccgcgcggc
tcgctcgtcgtgtgcaccgtcaccgggcacgggctcaaggaccccgacaccgcgctgctc
accgcgccggacccggagatcgtcccgatcgaccccgcggccgtcgcggccgctctggag
ctggcctga

DBGET integrated database retrieval system