KEGG   Pseudonocardia dioxanivorans: Psed_1735Help
Entry
Psed_1735         CDS       T01479                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00071  Fatty acid degradation
pdx00280  Valine, leucine and isoleucine degradation
pdx00281  Geraniol degradation
pdx00310  Lysine degradation
pdx00360  Phenylalanine metabolism
pdx00362  Benzoate degradation
pdx00380  Tryptophan metabolism
pdx00410  beta-Alanine metabolism
pdx00627  Aminobenzoate degradation
pdx00640  Propanoate metabolism
pdx00650  Butanoate metabolism
pdx00903  Limonene and pinene degradation
pdx00930  Caprolactam degradation
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01212  Fatty acid metabolism
Module
pdx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psed_1735
   00650 Butanoate metabolism
    Psed_1735
  Lipid metabolism
   00071 Fatty acid degradation
    Psed_1735
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psed_1735
   00310 Lysine degradation
    Psed_1735
   00360 Phenylalanine metabolism
    Psed_1735
   00380 Tryptophan metabolism
    Psed_1735
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psed_1735
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psed_1735
   00281 Geraniol degradation
    Psed_1735
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psed_1735
   00627 Aminobenzoate degradation
    Psed_1735
   00930 Caprolactam degradation
    Psed_1735
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psed_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEA23970
JGI: Psed_1735
UniProt: F4CKX7
Position
1833068..1833877
Genome map
AA seq 269 aa AA seqDB search
MTVTRVRVPGVTEFVSLEVDNGVGTIRLARPPMNALSRQVQEELLQVSTEAATRDDVRAV
VVYGGEKTFAAGADVKEMAAMSYSDMAPVARRLSAGLGSISTIPKPTVAAVTGYALGGGL
EVVLGADRRIAGDNAKLGFPEILLGIFPGGGGTQRLARLIGPARAKDLIYTGRFVDAQEA
LSIGLVDEVVPADDVYTRAVEYAAQFANGPALAYAAAKKAIDGGLDTDLRTGLDIESELF
ASLFASEDRTAGMQSFIENGPGKATFTGR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgacccgggttagggtcccgggcgtgacggagttcgtgagcctcgaggtcgac
aacggtgtgggcacgatccggctggcgcggccgccgatgaacgccctgagcaggcaggtc
caggaagagctgctgcaggtctccacggaggccgcgacgcgcgacgacgtgcgcgccgtc
gtcgtctacggcggtgagaagaccttcgcggcgggtgccgacgtcaaggagatggcggcg
atgtcctactcggacatggccccggtggcgcggcggctctccgcgggcctcggctcgatc
tcgacgatccccaagccgacggtcgcggccgtcaccggctacgcgctgggcggcgggctg
gaggtcgtcctcggtgccgaccggcgcatcgcgggcgacaacgccaagctcggcttcccc
gagatcctgctcggcatcttccccggcggcggcggcacccagcggctcgcgcggctgatc
ggtccggcgcgtgccaaggacctgatctacacgggccggttcgtcgacgcccaggaggcg
ttgtcgatcgggctggtcgacgaggtcgtccccgccgacgacgtctacacccgtgccgtc
gagtacgccgcgcagttcgcgaacggcccggcgctggcctacgcggcggcgaagaaggcc
atcgacggcggcctcgacaccgacctgcgcaccggcctcgacatcgagtccgagctgttc
gcgagcctgttcgccagcgaggaccggacggcgggcatgcagtcgttcatcgagaacggc
cccggcaaggcgacgttcacgggccgctga

DBGET integrated database retrieval system