KEGG   Pseudonocardia dioxanivorans: Psed_1766Help
Entry
Psed_1766         CDS       T01479                                 

Definition
(GenBank) urate oxidase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00230  Purine metabolism
pdx01100  Metabolic pathways
pdx01120  Microbial metabolism in diverse environments
Module
pdx_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Psed_1766
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Psed_1766
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Psed_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uricase
Motif
Other DBs
NCBI-ProteinID: AEA24001
JGI: Psed_1766
UniProt: F4CML7
Position
complement(1863754..1864611)
Genome map
AA seq 285 aa AA seqDB search
MTTTSTITLGANQYGKAENRVVRIYRDSPRHEIRDVTVSTALRGDFTAAHLEGDQAQVLP
TDTQKNTCYAYAKEKGLREIETYGLDLARHFVADVEPVTGASVAVDELFWDRVEVGGQGH
DHTWVRRGPEVRTTVVTVDGSGEQVVSGLRDLVLLKSTGSEFAGFLTDGYTTLAETHDRI
MSTSLVATWRYATTELDWDKTWSDVRRILLEQFAVVHSKALQQTLWEMGRAALEAHPEVA
EISLSAPNKHHFVVDLSPFGLDNPNEVFYAADRPYGLIEATVTRS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgtcgacgatcacgctgggcgccaaccagtacggcaaggccgagaaccgc
gtcgtgcgcatctaccgcgacagcccccggcacgagatccgtgacgtcacggtgtcgacg
gcgctgcgcggcgacttcaccgccgcccacctcgagggcgaccaggcgcaggtgctgccg
accgacacccagaagaacacctgctacgcctacgccaaggagaagggcctgcgcgagatc
gagacctacggcctcgacctggcccggcacttcgtcgccgacgtcgagccggtgaccggg
gccagcgtggcggtggacgagctgttctgggaccgcgtggaggtcggcggccagggccac
gaccacacctgggtccggcgcggccccgaggtgcgcacgacggtcgtgaccgtcgacggg
agcggcgagcaggtcgtctccgggctccgggacctggtgctgctcaagtcgaccggctcg
gagttcgccggcttcctcaccgacgggtacaccacgctggccgagacccacgaccggatc
atgtccacctcgctcgtcgcgacgtggcgctacgcgacgaccgagctcgactgggacaag
acgtggtcggacgtgcggcgcatcctgctcgagcagttcgccgtcgtgcactccaaggcg
ctgcagcagacgttgtgggagatgggccgcgccgcgctggaggcccaccccgaggtcgcc
gagatctcgctgtcggcaccgaacaagcaccacttcgtcgtggacctgtcgccgttcggc
ctggacaaccccaacgaggtcttctacgcggccgaccggccgtatggcttgatcgaggcc
acggtcacgcgttcctga

DBGET integrated database retrieval system