KEGG   Pseudonocardia dioxanivorans: Psed_1766Help
Entry
Psed_1766         CDS       T01479                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Psed_1766
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Psed_1766
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Psed_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1863754..1864611)
Genome map
AA seq 285 aa AA seqDB search
MTTTSTITLGANQYGKAENRVVRIYRDSPRHEIRDVTVSTALRGDFTAAHLEGDQAQVLP
TDTQKNTCYAYAKEKGLREIETYGLDLARHFVADVEPVTGASVAVDELFWDRVEVGGQGH
DHTWVRRGPEVRTTVVTVDGSGEQVVSGLRDLVLLKSTGSEFAGFLTDGYTTLAETHDRI
MSTSLVATWRYATTELDWDKTWSDVRRILLEQFAVVHSKALQQTLWEMGRAALEAHPEVA
EISLSAPNKHHFVVDLSPFGLDNPNEVFYAADRPYGLIEATVTRS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgtcgacgatcacgctgggcgccaaccagtacggcaaggccgagaaccgc
gtcgtgcgcatctaccgcgacagcccccggcacgagatccgtgacgtcacggtgtcgacg
gcgctgcgcggcgacttcaccgccgcccacctcgagggcgaccaggcgcaggtgctgccg
accgacacccagaagaacacctgctacgcctacgccaaggagaagggcctgcgcgagatc
gagacctacggcctcgacctggcccggcacttcgtcgccgacgtcgagccggtgaccggg
gccagcgtggcggtggacgagctgttctgggaccgcgtggaggtcggcggccagggccac
gaccacacctgggtccggcgcggccccgaggtgcgcacgacggtcgtgaccgtcgacggg
agcggcgagcaggtcgtctccgggctccgggacctggtgctgctcaagtcgaccggctcg
gagttcgccggcttcctcaccgacgggtacaccacgctggccgagacccacgaccggatc
atgtccacctcgctcgtcgcgacgtggcgctacgcgacgaccgagctcgactgggacaag
acgtggtcggacgtgcggcgcatcctgctcgagcagttcgccgtcgtgcactccaaggcg
ctgcagcagacgttgtgggagatgggccgcgccgcgctggaggcccaccccgaggtcgcc
gagatctcgctgtcggcaccgaacaagcaccacttcgtcgtggacctgtcgccgttcggc
ctggacaaccccaacgaggtcttctacgcggccgaccggccgtatggcttgatcgaggcc
acggtcacgcgttcctga

DBGET integrated database retrieval system