KEGG   Pseudonocardia dioxanivorans: Psed_1849Help
Entry
Psed_1849         CDS       T01479                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psed_1849
Enzymes [BR:pdx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Psed_1849
Peptidases [BR:pdx01002]
 Cysteine Peptidases
  Family C44
   Psed_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1958529..1961678
Genome map
AA seq 1049 aa AA seqDB search
MPGRHVCIVVQNLPVPFDRRVWLECRALAAAGYEVSVVCPKGPGDPSYQELEGVHIFKYR
AFPPITRQVMFLAEYAYSIVATLLGLAKAWRRNRFTVVQVCNPPDVLWTAVLPFTLLFGV
RMVFDQHDLCPELYESRFESAGSLPYKALVLAERATYALSSHVISTNESYRAVAMRRGRK
KPSDVTVVRTGPDPEKMRRREPDASLRHGHRHLLVYIGVMGPQDGVDLAIRAMEHIVHTR
GRSDVALTLIGDGDAAPALRALTTELRLDDHVVFTGRAPDDVVKGLMSTADIGLSPDPKN
ALNDVSTMNKTMEYMAFELPVVASTWWRRRCRPPTPRCTRRPTTSRSTGTRCSRSSTTRS
PASTWARSAGAGSRTCWPGATRSRPTSASTTGSSDPEEERPTMCGVAGTYLIPDGDRLTD
LMTDAVAHRGPDAAGRWSHRVGAGTVELGHRRLSIVDLSPTGAQPMAADGLVLTYNGELY
NAAELRAELEAAGVRFRGTSDTEVLLQAWRRWGTDCLPRLRGMFAFGVFDTATGELFLAR
DQLGIKPLFVVRRGGGLAFASELKALADAFGGDLHVDETALVASLLYYWVPDSRCAYKEA
EKLPPGSWLRVRPDGDVARGTYWSLREVAERAAHEPAPTAAELHEIVADSTRRHLIADVP
VATFLSGGLDSSYLTALAARERPGISAYTIGFRAEDAKFEAMPDDLRYARQVAQRYGVRL
HEIEIAPDVLEMLPMITRALDEPIGDPAAINTYLICSAAREAGVKVMVSGMGADELFAGY
RKHLANRLAVRYQRVPRAVRRPVHAAVDRLPVASATRGYRSVRFAKRFLSFAELGEEAAF
RRSYTMYDRGELLDLVSPDLAGAVDDVLTEHADVYTDNELTDHVNRMCLADARLFLPGLN
LGYTDRSSMAASTEVRVPFVDVDVVTAAFRARGVQKIVGRSGKTVLKQAATSILPAEIVH
RPKGLFSAPLRAWMSRDLAPLVREVVEDGVLVRSGFLRRDAAARLVAEDAAGREDRSKHL
WHIVTLEYWYRNATSAGGDLRTAVSGGAR
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggccggcatgtctgcatcgtggtgcagaacctgccggtgccgttcgaccgccgc
gtgtggctcgagtgcagggcgctcgcggccgcgggctacgaggtctcggtcgtatgcccg
aaggggccgggcgatccgtcctaccaggagctcgagggcgtccacatcttcaagtaccgg
gcgttcccgccgatcacccggcaggtcatgttcctggccgagtacgcgtactccatcgtc
gcgacgctgctcgggctcgcgaaggcgtggcggcgcaaccggttcacggtcgtgcaggtc
tgcaacccgccggacgtgctgtggaccgcggtgctgcccttcacgctgctgttcggcgtc
cggatggtgttcgaccagcacgacctgtgcccggagctgtacgagtcgaggttcgagtcg
gccgggtcgctgccctacaaggcgctcgtgctggccgagcgggcgacgtacgcgctgtcg
tcccacgtcatctcgacgaacgagtcctaccgggccgtcgcgatgaggcgcggccgcaag
aagccctcggacgtgaccgtggtgcgcaccggcccggacccggagaagatgcgccgccgg
gagccggacgcgtcgctgcgccacgggcaccggcacctgctcgtctacatcggggtgatg
ggcccgcaggacggcgtcgacctcgcgatccgggccatggagcacatcgtccacacgcgg
gggcgcagcgacgtcgcgctcacgctcatcggtgacggcgacgccgccccggcgctgcgc
gccctgaccaccgaactgcgcctcgacgaccacgtcgtcttcaccggccgcgcgcccgac
gacgtcgtcaagggactgatgtcgaccgcggacatcggcctctcgccggacccgaagaac
gcgctgaacgacgtctccacgatgaacaagacgatggagtacatggccttcgagctgccg
gtcgtcgcttcgacctggtggagacgaaggtgtcggccgccgacgccgcggtgtacgcga
cgcccaacgacgtcgcggagtacggggacgcggtgctcgcgctcctcgacgacgaggtca
cccgcaagcacatgggcgaggtcggcaggcgccgggtcgaggacgtgctggcctggcgcc
accagatcccgccctacgtcggcgtctacgaccggctcatcggatcctgaggaagagaga
ccgacgatgtgcggtgtcgcggggacgtacctgattcccgacggtgaccggctcaccgac
ctgatgaccgacgcggtcgcccaccgcggacccgacgccgccggccgctggtcgcaccgc
gtcggcgcgggcaccgtcgagctgggccaccgccggctgtcgatcgtcgacctgtccccg
accggtgcccagccgatggcggccgacggcctcgtgctcacctacaacggcgagctctac
aacgcggccgagctgcgcgccgagctggaggccgcgggggtgcgcttccgtggcacgtcg
gacaccgaggtgctgctgcaggcgtggcgacgctggggtaccgactgtctgccgcgcctg
cgggggatgttcgcgttcggggtgttcgacacggcgacgggcgagctgttcctggcccgc
gaccagctgggcatcaagccgctgttcgtcgtccgtcgcgggggcgggctcgcgttcgcc
tccgagctgaaggcgctcgccgacgcgttcggcggggatctgcacgtcgacgagacggcg
ctggtcgcgtcgctgctctactactgggtccccgacagccgctgtgcctacaaggaggcg
gagaagctgccgcccggcagctggctgcgggtccgtcccgacggggacgtcgcgcgcggc
acgtactggtcgctgcgcgaggtcgccgagcgggcggcgcacgagccggccccgaccgcc
gcggagctgcacgagatcgtcgccgactccacgcggcggcacctgatcgcggacgtgccg
gtcgcgacgttcctgtccggtggcctggactccagctacctgaccgcgctcgccgcgcgc
gagcgcccggggatctcggcctacacgatcggcttccgcgccgaggacgcgaagttcgag
gcgatgcccgacgacctgcgctacgcccgccaggtcgcgcagcggtacggcgtgcggctc
cacgagatcgagatcgcccccgacgtcctcgagatgctgccgatgatcacgcgggccctc
gacgagcccatcggggacccggccgcgatcaacacctatctgatctgctcggccgcccgc
gaggccggggtcaaggtcatggtctccggcatgggggccgacgagctgttcgccggctac
cgcaagcacctcgcgaaccggctggcggtgcgctaccagcgggtgccgcgggccgtccgc
cgcccggtgcacgccgcggtcgaccggctgcccgtcgcgagcgcgacgcgcgggtaccgg
tccgtccggttcgcgaagcgcttcctgtcgttcgccgagctgggggaggaggccgccttc
cggcgcagttacaccatgtacgaccggggcgagctgctcgacctcgtcagcccggatctc
gccggtgccgtcgacgacgtgctcaccgagcacgccgacgtctacaccgacaacgagctg
accgaccacgtgaaccggatgtgcctggccgacgcccggctgttcctgccggggctcaac
ctgggctacaccgaccggtccagcatggcggcctcgacggaggtgcgtgtcccgttcgtc
gacgtggacgtcgtgacggcagccttccgggcgcgcggcgtccagaagatcgtcgggcgg
tcgggcaagacggtactcaagcaggccgccacgtcgatcctgcccgccgagatcgtgcac
cggccgaagggcctgttcagcgcgccgttgcgggcgtggatgagccgcgacctggcaccg
ctcgtccgggaggtcgtcgaggacggcgtcctcgtccgctccggcttcctgcgccgcgac
gccgcggcccggctggtcgccgaggacgccgccggccgcgaggaccggtccaagcacctc
tggcacatcgtgacgttggagtactggtaccggaacgcgacgtcggcgggcggcgacctc
cggaccgccgtgagcgggggagcccgatga

DBGET integrated database retrieval system