KEGG   Pseudonocardia dioxanivorans: Psed_1991Help
Entry
Psed_1991         CDS       T01479                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00330  Arginine and proline metabolism
pdx00332  Carbapenem biosynthesis
pdx01100  Metabolic pathways
pdx01130  Biosynthesis of antibiotics
pdx01230  Biosynthesis of amino acids
Module
pdx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Psed_1991
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Psed_1991
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Psed_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEA24219
JGI: Psed_1991
UniProt: F4CWW4
Position
2122023..2123171
Genome map
AA seq 382 aa AA seqDB search
MTPRSVPGPRAQLAAARRLVVKVGSSSLTSLDGGIDPGRLDRLVDALAARRAAGSQVVLV
SSGAIAAGLAPLRLTRRPRDLATQQAAAAVGQLLLAHAYSASFARFDLDIGQVLLTADDM
IRRSHYRNAQRTLERLLGLDVLPVVNENDTVATDEIRVGDNDRLAALVAHIVGADGLVLL
SDVDGLYDGDPRRPGSSLVAEVEHPADLQAVEIAKPGQGTLGRGGMATKITAAAMASAAG
VPVLLTSADEVGAALDVAPDGPKVGTAFRPSGRRMSARRFWLRHAADVQGRLDLDAGAVA
AVIGRRRSLLAAGIHGISGDFVSGDVVDLVGPGGTVVARGVVGYDAGELPAIIGRRTSEL
PPEQRREVVHADDLVPLSDPAP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacaccccgcagcgtccccgggccccgggcccagctcgcggcggcgcgccggctcgtc
gtgaaggtcgggtcgtcgtcgctgaccagcctcgacggcggcatcgaccccgggcgtctc
gaccggctcgtcgacgcccttgcggcccggcgggccgcggggtcgcaggtcgtgctcgtg
tcctcgggtgcgatcgcggccgggctggcgccgctgcggctgacccgccgcccccgcgac
ctggccacccagcaggcggcggcggccgtcgggcagctgctgctcgcccacgcgtactcc
gcgtcgttcgcgcggttcgacctcgacatcgggcaggtcctgctcaccgccgacgacatg
atccggcgctcgcactaccgcaacgcccagcgcaccctcgaacggctgctgggcctcgac
gtgctgccggtcgtcaacgagaacgacaccgtcgccaccgacgagatccgcgtgggcgac
aacgaccggctcgccgcgctggtggcgcacatcgtcggcgcggacgggctcgtcctgctc
tccgacgtcgacggcctctacgacggcgacccccgccggccggggtcgtcgctcgtcgcc
gaggtggagcaccccgccgacctgcaggccgtggagatcgcgaagcccggccagggcacc
ctcggccgcggcgggatggccacgaagatcaccgccgcggcgatggcgtcggccgcgggc
gtgccggtgctgctgacgtcggccgacgaggtcggcgctgcgctcgacgtcgcgcccgac
gggcccaaggtcggcaccgcgttccggccctcggggcggcggatgtcggcacgccggttc
tggctgcggcacgccgccgacgtgcagggccgtctcgacctcgacgccggcgccgtggcc
gcggtcatcggacggcggcgctcgctgctcgccgcgggcatccacggcatctccggcgac
ttcgtctccggcgacgtcgtcgacctcgtcggcccgggcgggacggtcgtcgcgcgcggc
gtcgtcgggtacgacgccggcgagctgcccgcgatcatcggccggcgcacgtcggagctg
ccgcccgagcagcgccgcgaggtcgtgcacgccgacgacctcgtcccgctctccgacccc
gccccctga

DBGET integrated database retrieval system