KEGG   Pseudonocardia dioxanivorans: Psed_1992Help
Entry
Psed_1992         CDS       T01479                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pdx  Pseudonocardia dioxanivorans
Brite
Enzymes [BR:pdx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Psed_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2123331..2124581
Genome map
AA seq 416 aa AA seqDB search
MDPAQPAAPPRTDPAQEARARMVDALRRDGRVRSDTVAWAMSAVPRHLFLPDATVETAYA
DSAVVTKVVAGVALSSASQPSMVAIMLEQLDLHPGQRVLEIGAGTGYNAALIARLVGASG
AVTTVDIDEDIVVAAAGHLVAAGYPDVVLVTGDGALGHPPGAPYDRVVLTVGSADLRPEW
IAQLAPDGRLLLPLRVRGSQLSVAFDLGADGLLRSTSVRSCAFIRLRGAGAGAEPVAALG
TDGWSAEPADPGTPVPDPDALRAAVDRPGTEEPLGVRLSAADVWDGLGLWLALGEPRTLR
LVARGTAAESPAAAGLVAVAGARATIALPGTGGFVALVQDDAGGPARMRCHGDPGCDAVA
RLGALVDVWVAAGRPHAADLQLTAFPQGCAATPAAGDCLVELGSATLLVEYLGPVA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcgcagcccgcggcaccgccgcggacggacccggcgcaggaggcacgagcg
cggatggtcgacgcgctgcgtcgcgacggacgcgtgcggtccgacaccgtcgcgtgggcg
atgagcgcggtcccgcggcacctgttcctgccggacgccaccgtcgagaccgcctacgcg
gacagcgcggtcgtgaccaaggtcgtcgccggggtggcactgagctcggcgtcgcagccg
tcgatggtcgcgatcatgctcgagcagctcgacctgcaccccggccagcgggtgctggag
atcggcgccggcaccgggtacaacgcggcgctgatcgcccggctcgtcggggcctcaggc
gcggtcacgacggtcgacatcgacgaggacatcgtcgtcgccgccgccgggcacctggtc
gcggccgggtatcccgacgtcgtgctggtcaccggcgacggcgcgctcggccatccgccg
ggtgccccgtacgaccgggtcgtgctcacggtcggcagcgccgacctgcggcccgaatgg
atcgcccagctcgcgccggacggcaggctgctgctgccgctgcgggtcaggggcagccag
ctgtcggtggcgttcgacctcggcgcggacggcctgttgcgcagcacctcggtgcggtcg
tgcgcgttcatccggctgcggggggcgggtgcgggcgccgagccggtcgccgcactcggg
accgacggctggtcggccgaacccgccgaccccggcaccccggtacccgaccccgacgcg
ctgcgcgcggccgtggaccggcccgggaccgaggagccgctgggcgtgcggctctccgcg
gccgacgtctgggacggcctggggctctggctcgcgctcggcgagccgaggacgctgcgc
ctagtcgcccgcggcaccgcggcggagtcgcccgccgccgcgggcctggtcgcggtcgcg
ggtgcgcgcgcgacgatcgcgctgcccggcacgggcgggttcgtcgcgctcgtgcaggac
gacgccggtgggcctgcgcggatgcgctgccacggcgacccggggtgcgacgccgtcgcc
aggctgggcgctctcgtcgacgtctgggtggccgccggccgcccgcacgccgcggacctg
cagctcacggcgttcccacagggctgcgcggccaccccggccgcgggcgactgcctcgtg
gagctcgggtcggcgacgttgctcgtcgagtacctcggtccggtggcctga

DBGET integrated database retrieval system