KEGG   Pseudonocardia dioxanivorans: Psed_2006Help
Entry
Psed_2006         CDS       T01479                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_2006
   01230 Biosynthesis of amino acids
    Psed_2006
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_2006
  Energy metabolism
   00680 Methane metabolism
    Psed_2006
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_2006
Enzymes [BR:pdx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Psed_2006
Exosome [BR:pdx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Psed_2006
  Exosomal proteins of melanoma cells
   Psed_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2137433..2138059
Genome map
AA seq 208 aa AA seqDB search
MSLRRVVLLRHGQTDHNVDGRMQGHVDSTLTARGLGQARAVAPELARFAPARLISSDLSR
AARTAAEVAAVTGLPVEYDVRLRETDLGDWGGMSIVDIERTTPGAIDAWRSDPTWRPPGG
ETRVEVVARSVPLVEELDAEYADTEADVTVLLVAHSGVIAGMVSGLLDLPQTVWPAVGGM
GNAHWAVLGRRPGKSMWRLTGYNVGLDR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgcgcagggtcgtcctgctgcggcacgggcagaccgaccacaacgtcgacggc
cgcatgcagggacacgtcgactcgacgctcaccgcccgcggcctcggtcaggcccgtgcg
gtggcgcccgagctggcgcgcttcgcgccggcccgcctgatcagctccgacctcagccgc
gcggcccgcacggcggccgaggtcgcggccgtgaccgggctgcccgtcgagtacgacgtg
cggctccgcgagaccgacctcggcgactggggcggcatgtcgatcgtcgacatcgagcgg
acgacgccaggcgcgatcgacgcctggcgctccgacccgacctggcggccgcccggcggc
gagacccgcgtcgaggtcgtcgcgcggtcggtgccgctggtcgaggagctcgacgcggag
tacgccgacacggaggccgacgtcaccgtgctgctcgtcgcgcacagcggggtcatcgcc
gggatggtgtccggcctgctcgacctgccgcagaccgtgtggcccgccgtgggcggcatg
ggcaacgcgcactgggccgtgctcggccgcagacccggcaagtcgatgtggcgcctcacc
ggctacaacgtgggtctcgaccgatga

DBGET integrated database retrieval system