KEGG   Pseudonocardia dioxanivorans: Psed_2006Help
Entry
Psed_2006         CDS       T01479                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
pdx  Pseudonocardia dioxanivorans
Brite
Enzymes [BR:pdx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     Psed_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2137433..2138059
Genome map
AA seq 208 aa AA seqDB search
MSLRRVVLLRHGQTDHNVDGRMQGHVDSTLTARGLGQARAVAPELARFAPARLISSDLSR
AARTAAEVAAVTGLPVEYDVRLRETDLGDWGGMSIVDIERTTPGAIDAWRSDPTWRPPGG
ETRVEVVARSVPLVEELDAEYADTEADVTVLLVAHSGVIAGMVSGLLDLPQTVWPAVGGM
GNAHWAVLGRRPGKSMWRLTGYNVGLDR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgcgcagggtcgtcctgctgcggcacgggcagaccgaccacaacgtcgacggc
cgcatgcagggacacgtcgactcgacgctcaccgcccgcggcctcggtcaggcccgtgcg
gtggcgcccgagctggcgcgcttcgcgccggcccgcctgatcagctccgacctcagccgc
gcggcccgcacggcggccgaggtcgcggccgtgaccgggctgcccgtcgagtacgacgtg
cggctccgcgagaccgacctcggcgactggggcggcatgtcgatcgtcgacatcgagcgg
acgacgccaggcgcgatcgacgcctggcgctccgacccgacctggcggccgcccggcggc
gagacccgcgtcgaggtcgtcgcgcggtcggtgccgctggtcgaggagctcgacgcggag
tacgccgacacggaggccgacgtcaccgtgctgctcgtcgcgcacagcggggtcatcgcc
gggatggtgtccggcctgctcgacctgccgcagaccgtgtggcccgccgtgggcggcatg
ggcaacgcgcactgggccgtgctcggccgcagacccggcaagtcgatgtggcgcctcacc
ggctacaacgtgggtctcgaccgatga

DBGET integrated database retrieval system