KEGG   Pseudonocardia dioxanivorans: Psed_2011Help
Entry
Psed_2011         CDS       T01479                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psed_2011
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_2011
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psed_2011
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psed_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2143417..2144682)
Genome map
AA seq 421 aa AA seqDB search
MTLTAAAQTTSLDLGPARALSCRECGHETPLAAEFACPECFGPLEVAYDFPAVTRESIQA
GPQSIWRYRDLLPVPSDVQSHPNTEPGMTRLIKADRLAAALGVRSLWVKDDTGNPTHSFK
DRVVAVALAAARELGFTVLCCPSTGNLANAVAAAAARAGWDSVVLIPSSLEKAKVLTTAV
YGGTLLAVDGNYDDVNRLATELAAEHEEWAFVNVNVRPYYAEGSKTLGYEVAEQLGWRLP
EQIVVPIASGSQLTKVDKGFAEFGKLGLVDATPYKVFGAQATGCSPVAKAFEDGHDVVQP
VRPDTIARSLAIGNPADGPYVLDAVRRTGGAIGHVSDDEVRDGIQLLARTEGVFAETAGG
VTVATAKKLIEAGKIDPDAETVLLITGDGLKTLDAVADRVGPTATVASSSKAVKEALAGR
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacccttactgccgctgcgcagaccacctccctcgatctgggccccgcccgagccctg
tcttgtcgtgagtgcggccacgagaccccgctggccgcggagttcgcctgtcccgagtgt
ttcgggcccctcgaggtggcctacgacttcccggcggtgaccagggagtcgatccaggcc
ggcccgcagtcgatctggcgctatcgcgacctgctccccgtgccgtccgacgtgcagtcg
cacccgaacaccgagcccgggatgacccggctgatcaaggccgaccggctggccgccgcg
ctgggtgtgcggtcgctctgggtcaaggacgacaccggcaacccgacgcactcgttcaag
gaccgcgtcgtcgccgtcgcgctcgccgccgcccgcgagctgggcttcaccgtgctgtgc
tgcccgtcgaccgggaacctggccaacgccgtcgccgccgcggccgcccgcgcgggctgg
gactccgtcgtgctgatcccctcgtcgctggagaaggccaaggtcctcaccaccgcggtc
tacggcggcacgctgctggccgtcgacggcaactacgacgacgtcaaccggctcgccacc
gagctcgccgccgagcacgaggaatgggcgttcgtcaacgtcaacgtccgtccgtactac
gcggagggctcgaagacgctgggctacgaggtcgccgagcagctcggctggcggctgccc
gagcagatcgtcgtcccgatcgcgtcggggtcgcagctgaccaaggtcgacaaggggttc
gccgagttcggcaagctcggcctggtggatgcgacgccgtacaaggtgttcggcgcccag
gccaccggctgctcgcccgtcgcgaaggcgttcgaggacgggcacgacgtcgtccagccc
gtgcggccggacacgatcgcccgctcgctcgcgatcggcaaccccgccgacggcccctac
gtcctcgacgcggtccgccgcaccggtggcgcgatcgggcacgtgtccgacgacgaggtg
cgcgacggcatccagctgctcgcccggaccgagggcgtgttcgccgagaccgcgggcggt
gtcaccgtcgcgaccgcgaagaagctcatcgaggccggcaagatcgaccccgacgccgag
accgtcctgctcatcaccggtgacggcctgaagaccctcgacgccgtcgccgaccgggtc
ggcccgaccgccacggtcgcgtcgagcagcaaggccgtcaaggaggccctcgccgggcgc
ggctga

DBGET integrated database retrieval system