KEGG   Pseudonocardia dioxanivorans: Psed_2312Help
Entry
Psed_2312         CDS       T01479                                 

Definition
chemotaxis protein CheR (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pdx02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pdx02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2465852..2467690
Genome map
AA seq 612 aa AA seqDB search
MSQPDPGFEALLQHLKQTRGFDFTGYKRSSLVRRVARRMSQVGVSEYGDYLDHLELHAEE
FTALFNTILINVTGFFRDADAWEFLRTEVLPDLLASKGPTEPVRVWSAGCASGEEAYTLA
IVLAEMLGPAEFRDRVKIYATDVDEEALSYARHGTYSEREVGGVPDELRERYFEQVGGRF
TFRKDLRRSVIFGRNDLVQDAPISRIDLLVCRNTLMYFNAETQARILARFHFGLAEHGVL
FLGKAEMLLSHGSLFLPVDLKRHTFRKTPRVAPQNGTLFADPPPLVTRSSPEGIDLLRDE
AVLASPLAQVVLNGDGIVAVVNRQAEVLFGISTRDVGRPFRDLELSYRPLELRRHIEKAL
DERRTVRVTDVTYHRGPEVVHLEVQVSPLASGGGNEPLGVSVAFHDVTDFRRLQDELEQA
NRQLETAYEELQSTNEELETTNEELRSTVEELETTNEELQSTNEELETMNEELQSTNDEL
QDRTSELDRSNEFLETILTSLRAGVVVVGTELVVQVWNHQAEELWGLRRDEAVGEHLLNL
DIGLPLDLVRPVVRGTLAGEDGPQEVTLAAVNRRRRTIDVRVVASPLRGDTGTVVGAILT
MEEASSVEDLVR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcagccggatccgggtttcgaggccctgctgcagcatctgaagcagacccgcggg
ttcgacttcaccgggtacaagcggagcagcctggtccgccgggtcgcccgccggatgtcg
caggtcggggtcagcgagtacggcgactacctcgaccacctcgagctgcacgccgaggag
ttcacggcgctgttcaacaccatcctgatcaacgtcaccgggttcttccgggacgccgac
gcgtgggagttcctgcggaccgaggtgctgccggacctgctcgccagcaaggggccgacc
gagccggtccgggtgtggagcgcgggctgtgcgtcgggcgaggaggcctacaccctggcg
atcgtcctggccgagatgctcgggccggcggagttccgggaccgcgtgaagatctacgcc
accgacgtcgacgaggaggcgttgtcctacgcgcggcacggcacctactccgagcgggag
gtgggtggcgtccccgacgagctgcgcgagcgctacttcgagcaggtcggtggccggttc
accttccgcaaggacctccgccgctcggtgatcttcggacgcaacgacctggtgcaggac
gcgcccatctcgcgcatcgacctgctggtctgccgcaacacactcatgtacttcaacgcc
gagacccaggcacggatcctggcccggttccacttcggactcgccgagcacggtgtgctg
ttcctcggcaaggcggagatgctgctcagccacggttcgctgttcctgccggtggacctc
aagcgccacaccttccgcaagacgccgcgggtcgcgccgcagaacgggacgctgttcgca
gacccgccgcccctggtgacgcggtcctcgcccgagggcatcgacctgctccgcgacgag
gcggtgctcgcgtcgccgctggcgcaggtcgtcctcaacggcgacgggatcgtcgccgtg
gtcaaccggcaggccgaggtgctgttcggcatctcgacgcgcgacgtcggccgccccttc
cgggacctggagctgtcctaccggccgctggagctgcgcaggcacatcgagaaggcgctg
gacgagcggcggacggtccgcgtcaccgacgtcacctaccaccgtgggccggaggtcgtg
cacctcgaggtccaggtcagcccgttggcgagcggcggcgggaatgaaccgctgggcgtc
agcgtcgcgttccacgacgtgaccgacttccgccggctccaggacgagctcgagcaggcc
aaccgccagctcgagaccgcctacgaggagctgcagtcgacgaacgaggagctggagacc
accaacgaggagctgcggtccacggtcgaggagctggagaccaccaacgaggagctgcag
tccacgaacgaggagctggagacgatgaacgaggagctgcagtcgaccaacgacgagctc
caggaccgcacgagcgagctggaccgcagcaacgagttcctcgagacgatcctcaccagc
ctgcgggcgggggtcgtcgtcgtcggcaccgagctggtcgtccaggtgtggaaccaccag
gcggaggagctgtgggggctgcgccgcgacgaggccgtcggcgagcacctgctcaacctc
gacatcggcctcccgctcgacctggtgcggccggtcgtgcgcggcaccctcgcgggcgag
gacggcccgcaggaggtgaccctcgccgccgtcaaccgccggcgtcgcaccatcgacgtc
cgggtggtcgcgagcccgctgcggggtgacacgggtacggtcgtcggggccatcctgacg
atggaggaggcgtccagcgtggaggacctcgtccgctga

DBGET integrated database retrieval system