KEGG   Pseudonocardia dioxanivorans: Psed_2312Help
Entry
Psed_2312         CDS       T01479                                 

Definition
(RefSeq) chemotaxis protein CheR (EC:2.1.1.80)
  KO
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psed_2312
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Psed_2312
Enzymes [BR:pdx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Psed_2312
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psed_2312
Two-component system [BR:pdx02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Psed_2312
Bacterial motility proteins [BR:pdx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Psed_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
CheR PAS_4 PAS PAS_9 CheR_N PAS_8 PAS_10 IncA Rootletin Spc7 PAS_7 APG17 Golgin_A5 APG6 Syntaxin-6_N HMMR_N TPR_MLP1_2 Exonuc_VII_L KASH_CCD TMPIT HOOK CALCOCO1 IFT57 Fez1 DUF4795 DUF3584 DUF342 Atg14 DUF3450 Fusion_gly CENP-F_leu_zip DUF812 DUF1664 LMBR1 Flagellin_N Methyltransf_31 COG2 PHM7_cyt HemX DUF4407 HAUS-augmin3 TBPIP Tropomyosin Mnd1 SesA TACC AAA_23 AAA_13 DUF2009 MCPsignal Lipoprotein_7 DUF4686 RPW8 UPF0449 BST2 DUF3540 DUF16 DUF745 Jnk-SapK_ap_N WEMBL FAM76 Seryl_tRNA_N FliJ FUSC bZIP_1 MCC-bdg_PDZ zf-C4H2 DASH_Duo1 Bap31 OmpH GAS Reo_sigmaC TTKRSYEDQ TelA Snapin_Pallidin THOC7 ADIP TMF_TATA_bd Fmp27_WPPW Fzo_mitofusin DUF4618 Apt1 TMEM214 FemAB Tropomyosin_1 ATG16 ZapB EzrA DUF5089 Cluap1 Prominin Phage_GPO tRNA-synt_1d HIP1_clath_bdg DUF724 Cauli_AT GIT_CC V_ATPase_I Cep57_CLD_2 DUF4200 KfrA_N HALZ
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
2465852..2467690
Genome map
AA seq 612 aa AA seqDB search
MSQPDPGFEALLQHLKQTRGFDFTGYKRSSLVRRVARRMSQVGVSEYGDYLDHLELHAEE
FTALFNTILINVTGFFRDADAWEFLRTEVLPDLLASKGPTEPVRVWSAGCASGEEAYTLA
IVLAEMLGPAEFRDRVKIYATDVDEEALSYARHGTYSEREVGGVPDELRERYFEQVGGRF
TFRKDLRRSVIFGRNDLVQDAPISRIDLLVCRNTLMYFNAETQARILARFHFGLAEHGVL
FLGKAEMLLSHGSLFLPVDLKRHTFRKTPRVAPQNGTLFADPPPLVTRSSPEGIDLLRDE
AVLASPLAQVVLNGDGIVAVVNRQAEVLFGISTRDVGRPFRDLELSYRPLELRRHIEKAL
DERRTVRVTDVTYHRGPEVVHLEVQVSPLASGGGNEPLGVSVAFHDVTDFRRLQDELEQA
NRQLETAYEELQSTNEELETTNEELRSTVEELETTNEELQSTNEELETMNEELQSTNDEL
QDRTSELDRSNEFLETILTSLRAGVVVVGTELVVQVWNHQAEELWGLRRDEAVGEHLLNL
DIGLPLDLVRPVVRGTLAGEDGPQEVTLAAVNRRRRTIDVRVVASPLRGDTGTVVGAILT
MEEASSVEDLVR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcagccggatccgggtttcgaggccctgctgcagcatctgaagcagacccgcggg
ttcgacttcaccgggtacaagcggagcagcctggtccgccgggtcgcccgccggatgtcg
caggtcggggtcagcgagtacggcgactacctcgaccacctcgagctgcacgccgaggag
ttcacggcgctgttcaacaccatcctgatcaacgtcaccgggttcttccgggacgccgac
gcgtgggagttcctgcggaccgaggtgctgccggacctgctcgccagcaaggggccgacc
gagccggtccgggtgtggagcgcgggctgtgcgtcgggcgaggaggcctacaccctggcg
atcgtcctggccgagatgctcgggccggcggagttccgggaccgcgtgaagatctacgcc
accgacgtcgacgaggaggcgttgtcctacgcgcggcacggcacctactccgagcgggag
gtgggtggcgtccccgacgagctgcgcgagcgctacttcgagcaggtcggtggccggttc
accttccgcaaggacctccgccgctcggtgatcttcggacgcaacgacctggtgcaggac
gcgcccatctcgcgcatcgacctgctggtctgccgcaacacactcatgtacttcaacgcc
gagacccaggcacggatcctggcccggttccacttcggactcgccgagcacggtgtgctg
ttcctcggcaaggcggagatgctgctcagccacggttcgctgttcctgccggtggacctc
aagcgccacaccttccgcaagacgccgcgggtcgcgccgcagaacgggacgctgttcgca
gacccgccgcccctggtgacgcggtcctcgcccgagggcatcgacctgctccgcgacgag
gcggtgctcgcgtcgccgctggcgcaggtcgtcctcaacggcgacgggatcgtcgccgtg
gtcaaccggcaggccgaggtgctgttcggcatctcgacgcgcgacgtcggccgccccttc
cgggacctggagctgtcctaccggccgctggagctgcgcaggcacatcgagaaggcgctg
gacgagcggcggacggtccgcgtcaccgacgtcacctaccaccgtgggccggaggtcgtg
cacctcgaggtccaggtcagcccgttggcgagcggcggcgggaatgaaccgctgggcgtc
agcgtcgcgttccacgacgtgaccgacttccgccggctccaggacgagctcgagcaggcc
aaccgccagctcgagaccgcctacgaggagctgcagtcgacgaacgaggagctggagacc
accaacgaggagctgcggtccacggtcgaggagctggagaccaccaacgaggagctgcag
tccacgaacgaggagctggagacgatgaacgaggagctgcagtcgaccaacgacgagctc
caggaccgcacgagcgagctggaccgcagcaacgagttcctcgagacgatcctcaccagc
ctgcgggcgggggtcgtcgtcgtcggcaccgagctggtcgtccaggtgtggaaccaccag
gcggaggagctgtgggggctgcgccgcgacgaggccgtcggcgagcacctgctcaacctc
gacatcggcctcccgctcgacctggtgcggccggtcgtgcgcggcaccctcgcgggcgag
gacggcccgcaggaggtgaccctcgccgccgtcaaccgccggcgtcgcaccatcgacgtc
cgggtggtcgcgagcccgctgcggggtgacacgggtacggtcgtcggggccatcctgacg
atggaggaggcgtccagcgtggaggacctcgtccgctga

DBGET integrated database retrieval system