KEGG   Pseudonocardia dioxanivorans: Psed_2597Help
Entry
Psed_2597         CDS       T01479                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Psed_2597
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Psed_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2746216..2746971
Genome map
AA seq 251 aa AA seqDB search
MSLTDSAPTTQPVISESDPRFQIAAARRILHREGLDSQVGGHVSLRVPGEEAFLVTPFQY
FDETLPEHVSKVGFDLQVIEPGTLPASPGINFHASIYSARPDVNCVIHTHAKNMSVLSTT
GEPYGVYYDYASLLLDEVVPWVDDPNLVPSEEGELMVAALGSKKALLMGHHGSLHVGDTL
ERVTMEALIMELCAGYQLAAMAVGGKPLDRQIAESYRGAYLKNKFREQMWIANYRRLIRS
DPDLFATLQRG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcaccgacagcgcgccgaccacccagcccgtgatcagcgagagcgacccgcgg
ttccagatcgccgcggcgcggcgcatcctgcaccgcgagggtctggacagtcaggtcggc
ggacacgtcagcctgcgcgtccccggcgaggaggccttcctcgtcacgcccttccagtac
ttcgacgagacgctgcccgagcacgtcagcaaggtcggcttcgacctccaggtcatcgag
cccggcacgctgccggcctcgcccggcatcaacttccacgcctcgatctactcggcgcgg
ccggacgtgaactgcgtgatccacacccacgcgaagaacatgtcggtgctgagcacgacg
ggtgagccctacggggtctactacgactacgcctcgctgctgctcgacgaggtcgtgccg
tgggtcgacgacccgaacctcgtcccctccgaggagggcgagctcatggtcgccgcgctc
gggagcaagaaggcgctgctcatgggccaccacgggtcgctgcacgtcggcgacacgctg
gagcgggtcacgatggaggcgctgatcatggagctgtgcgccggctaccagctggcggcc
atggccgtcggcggcaagccgctcgaccgtcagatcgccgagagctaccgcggcgcgtac
ctgaagaacaagttccgcgagcagatgtggatcgcgaactaccgccgactgatccgcagc
gacccggacctcttcgcgacgctgcagcgcggctga

DBGET integrated database retrieval system