KEGG   Pseudonocardia dioxanivorans: Psed_2717Help
Entry
Psed_2717         CDS       T01479                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_2717
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_2717
   00620 Pyruvate metabolism
    Psed_2717
   00640 Propanoate metabolism
    Psed_2717
  Energy metabolism
   00680 Methane metabolism
    Psed_2717
Enzymes [BR:pdx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psed_2717
Lipid biosynthesis proteins [BR:pdx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psed_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2871122..2872804
Genome map
AA seq 560 aa AA seqDB search
MTEADAFYAARDFLLTHRTDYDTAVRDFRWPQLTEFNWALDHFDNVAADPERGARRALWI
VESDGSEAYWTFAEMSSRSDRVANWLRAQGVARGDRIILMLGNQLELWETLLAAMKLGAV
VIPATTLLTAEDLRDRVERGNARHVVVGGADAGKFDDVAGDYTRIAVRGAPSGWLDYTEA
YDVADTFVPDGVTRADDTLLLYFTSGTTAKPKLVEHTHQSYPVGHLSTMYWIGLEPGDVH
LNISSPGWAKHAWSNVFAPWIAEATVLVMNYARFDAESVLGVLERCGVDSFCAPPTVWRM
LIQADLSTLRTPPQKVVGAGEPLNPEVIEQVEKAWGVRIRDGFGQTESSVQIGNPPGQTV
KPGSMGRPIPGFPIELIDPATGEKSDEGEICIDLSRRPTGLMVGYYGDDERNAEAMAGGY
YHTGDVGSRDADRYITYVGRSDDVFKASDYRISPFELESVLIEHPAVAEAAVVPSPDPVR
LAVPKAYVVLAAGHTPDEATARSILEFARDNLAPYKRIRRLEFADLPKTISGKIRRVELR
GREQDIHGSEAATAQGEYTL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcggatgccttctacgcggcgcgcgacttcctgctgacccaccgcaccgac
tacgacacggccgtccgcgacttccgctggccgcagctcaccgagttcaactgggccctc
gaccacttcgacaacgtcgccgccgatcccgagcgtggcgcccgccgggcgctgtggatc
gtcgagagcgacggctcggaggcgtactggacgttcgcggagatgtcgtcgcgctccgac
cgcgtggcgaactggctgcgtgcccagggtgtcgcgcgcggtgaccggatcatcctcatg
ctgggcaaccagctcgagctgtgggagacgctgctcgcggcgatgaagctcggcgcggtc
gtcatcccggcgacgacgctgctcaccgccgaggacctgcgcgaccgggtcgagcgcggc
aacgcccggcacgtggtcgtcggcggtgccgacgccggcaagttcgacgacgtcgcgggc
gactacacgcgcatcgccgtgcggggcgcgccgtccggctggctcgactacaccgaggcc
tacgacgtcgccgacacgttcgtgcccgacggcgtcacccgggccgacgacacgctgctg
ctctacttcacctccggcacgacggccaagccgaagctggtcgagcacacccaccagtcc
tacccggtcggccacctgtcgacgatgtactggatcgggctggagcccggcgacgtgcac
ctcaacatctcctcgccgggctgggccaagcacgcctggtccaacgtcttcgcgccgtgg
atcgccgaggccaccgtgctcgtcatgaactacgcacggttcgacgcggagagcgtgctg
ggcgtgctggagcgctgcggcgtcgacagcttctgcgccccgccgacggtgtggcgcatg
ctcatccaggccgacctgtcgacgctgcgcaccccgccgcagaaggtcgtcggggcgggg
gagccgctcaaccccgaggtcatcgagcaggtcgagaaggcctggggcgtgcggatccgc
gacggcttcggccagaccgagtcgagcgtgcagatcggcaacccgcccgggcagaccgtc
aagcccggctcgatgggccggcccatcccgggcttcccgatcgagctgatcgaccccgcg
acgggcgagaagagcgacgagggcgagatctgcatcgacctgtcgcgccgcccgacgggg
ctgatggtcggctactacggcgacgacgagcgcaacgccgaggccatggccggcggctac
taccacaccggcgacgtcggctcccgcgacgcggaccgctacatcacctacgtcggccgc
tccgacgacgtcttcaaggccagcgactaccggatcagcccgttcgagctggagagcgtg
ctgatcgagcacccggcggtcgcggaggcggccgtcgtgccctcgcccgatccggtgcgg
ctcgcggtgccgaaggcctacgtcgtcctggcggccgggcacacgcccgacgaggcgacg
gcccgctcgatcctcgagttcgcgcgcgacaacctggcgccctacaagcggatccggcgc
ctcgagttcgccgacctgcccaagacgatctccggcaagatccgtcgcgtcgagctgcgc
gggcgcgagcaggacatccacggctccgaggcggcgaccgcgcagggcgagtacaccctg
tga

DBGET integrated database retrieval system