KEGG   Pseudonocardia dioxanivorans: Psed_2723Help
Entry
Psed_2723         CDS       T01479                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psed_2723
Enzymes [BR:pdx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Psed_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2877719..2879986
Genome map
AA seq 755 aa AA seqDB search
MTTPGLMHARFPFSAVVGHDDLRLALLLNAVHPGVGGVLVRGEKGTAKSTAVRALAALLP
AVEVVEGCRFGCDPAAPDPGCPDGPHGPGAVVGRRPARLVELPVGASEDRLVGALDLERA
LAEGVRAYQPGLLAAAHRGVLYVDEVNLLHDHLVDVLLDAAAMGRAHVERDGVSVSHAAR
FLLVGTMNPEEGELRPQLLDRFGLTVEVAASREVATRAEVVRRGLAFEADPVGFAAGWAE
AEREVAARIVAARARVGAVVLADRELRRIAGVCAAVEVDGMRADLVIARAAVAHAAWRGA
GSVAELDVRVAARLALPHRRRRDPFDEPGIDEQTLDDALRSAAENLDDEPDPPSPGGPGS
NGSAPDGSAPDGSARDGSARDGSGPEGSAGDGSGPPGSAPAGAGADGSGTEASRADGARA
RGSHPDDSGRAGSRPDGAQADGSWPDGSAADGARADGSPADGAGSSGSGSSGPAGRAVPV
PTPVRLAASAARRFRVPGVGDGAPGRRSRARTDSGRVVRATAAAPRRAADLHLPATLAAA
APLQAARGRRGREVVVRSSDLRGAEREGREGNLVLFVVDASGSMAARRRMSAVSGAVLAL
LRDAYRRRDKVGLVTFRGGAAEVALPPTSSVPTAQTRLATLRTGGRTPLAQGLLRARRVL
DAERRRDPRRRALVVLLTDGRATVAARPGGDPVADACRAAGLLAADGVHTVVVDCESGPV
RLGLAGTVAGHAGAELVRLDELTAESVANVVTRAA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccgggcctcatgcacgcgcgtttcccgttctcggccgtcgtcgggcacgac
gacctgcggttggcgctgctgctcaacgcggtccatccgggtgtgggtggggtgttggtg
cggggggagaagggcaccgcgaagtcgacggcggtgcgtgcgctggcggcgctgctgccc
gcggtggaggtggtcgagggctgccggttcggctgtgacccggccgcccccgacccgggc
tgtccggacgggccgcacggcccgggtgcggtggtgggccggcgtccggcgcggttggtc
gagttgccggtcggggcgagtgaggaccggctggtcggggcgctggatctggagcgggcg
ctggccgagggggtgcgggcctaccagccggggttgttggccgcggcgcaccgcggggtg
ctctatgtcgacgaggtgaacctgctgcacgaccatctcgtggatgtgttgctcgacgcg
gcggcgatggggcgggcgcacgtggagcgggatggggtgtcggtgtcgcatgcggcgcgg
tttttgctggtcgggacgatgaacccggaggagggggagctgcgtccgcagttgttggac
cggttcgggttgaccgtggaggtggccgcgtcgcgggaggtcgcgacgcgggcggaggtg
gtgcggcgggggctggcgttcgaggcggatccggtggggttcgcggcgggctgggccgag
gcggagcgggaggtggcggcgcggatcgtggcggcgcgggcgcgggtgggcgcggtggtg
ttggcggatcgggagctgcggcggatcgcgggggtgtgtgcggcggtggaggtcgacggg
atgcgcgcggatctggtgatcgcgcgggcggcggtggcgcatgcggcgtggcggggggcc
gggtcggtggccgagctggatgttcgggtggcggcgcggttggcgttgccgcaccggcgg
cgtcgggatccgttcgacgagccggggatcgacgagcagaccctcgacgacgccctgcgc
tcggccgcggagaacctggacgacgagccggatccgccgtcaccgggtggtccgggctcg
aacggttcggccccagacggttcggccccagacggttcggcccgagacggttcggcccga
gacggttcgggcccggagggttcggccggggatggttcgggcccacccggttcggcgcca
gctggtgcgggggccgacggttcggggacggaggcgtcgcgagccgacggcgcccgggcc
cgcggctcgcaccccgacgactccgggcgagccggttcgcggccggacggtgcgcaggca
gatggttcgtggcctgacggttcggcggcggacggggcgcgggccgatggttcgccggcc
gacggtgcgggctcgtccggatcgggctcgtccggccccgcgggccgggccgttcccgtt
ccgaccccggtgcggctcgccgcctcggctgcccgccggttccgggtccccggcgtcggc
gacggcgccccgggccgtcgttcacgggcccgtaccgactccggccgggtcgtccgcgcg
acggccgccgcgccgcgccgcgccgctgatctgcaccttcccgccaccctcgccgcggcg
gcgcccctgcaggccgcgcgcggccgccgcgggcgcgaggtcgtcgtgcggtcgtcggac
ctgcggggtgccgagcgcgagggccgcgagggaaacctggtgctgttcgtcgtcgacgcg
tccgggtcgatggccgcccgcaggcggatgagcgcggtgtcgggtgcggtgctcgcgctg
ctgcgcgacgcctaccggcgccgcgacaaggtcggcctcgtgaccttccggggcggcgcg
gccgaggtcgcgctgccgccgacgtcgagcgtccccaccgcgcagacccggctcgcgacg
ctgcgcacgggcgggcgcaccccgctcgcccagggcctgctgcgcgcccgccgggtcctc
gacgccgaacgccgccgcgacccccgtcgccgcgccctggtcgtgctgctgaccgacggc
cgcgcgaccgtcgccgcccggcccggtggcgacccggtggccgacgcctgccgcgccgcc
ggcctgctcgcggccgacggggtgcacaccgtcgtcgtcgactgcgagagcgggcccgtg
cgcctcggcctcgcggggaccgtcgcgggccacgccggcgccgagctggtccggctcgac
gagctgaccgccgagtcggtcgcgaacgtcgtcacccgcgccgcctga

DBGET integrated database retrieval system