KEGG   Pseudonocardia dioxanivorans: Psed_2864Help
Entry
Psed_2864         CDS       T01479                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psed_2864
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psed_2864
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psed_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3028806..3029645
Genome map
AA seq 279 aa AA seqDB search
MGERTKQTSGPTVLESIVAGVREDLAVREAAVDFAEIKRRAAEAPPARDVMAALNAPGVG
VIAEVKRRSPSKGDLASIGDPADLARRYEIGGARVISVLTEQRRFGGSLADLDAVRAAVD
IPILRKDFVVSPYQVHEARAHGADLVLLIVAALEQNVLASLLDRVESLGMTALVEVHTEE
EADRALEAGATLIGVNARNLHTLEVDRGIFGRIAPGLPNNVLRVAESGVRGPGDLLTYAG
WGADAVLVGEGLVTSGDPEGAVRGLVAAGFHPSCSRMVR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcacgaagcagacctccggacccaccgtcctcgaatcgatcgtcgccggt
gtccgcgaggatctcgccgtccgtgaggccgccgtcgacttcgccgagatcaagcgacgt
gccgccgaggcaccgccggcgcgcgacgtgatggccgccctgaacgcccccggcgtcggg
gtgatcgccgaggtcaagcgccgcagcccgtcgaagggcgacctcgcctcgatcggtgat
ccggcggacctcgcgcggcgctacgagatcggtggtgcgcgggtgatcagcgtgctcacc
gagcagcgccgcttcggcggctcgctggccgacctcgacgcggtccgcgcggccgtcgac
atcccgatcctgcgcaaggacttcgtcgtcagcccctaccaggtgcacgaggcgcgggcg
cacggcgcggacctggtcctgctgatcgtcgcggcgctggagcagaacgtcctggcgtcg
ctgctcgaccgggtcgagtccctcgggatgacggcgctggtcgaggtgcacaccgaggag
gaggccgaccgggcgctcgaggccggcgcgacgctgatcggcgtcaacgcccgcaacctg
cacacgctcgaggtcgaccgcgggatcttcgggcggatcgcgccgggcctgcccaacaac
gtgctgcgcgtcgccgagtcgggcgtgcgcgggccgggcgacctgctcacctacgccggg
tggggcgccgatgcggtgctcgtcggcgagggtctggtgaccagcggcgaccccgagggc
gccgtacgtggtctggtggcggcgggcttccacccgtcgtgttcacggatggtgcgctga

DBGET integrated database retrieval system