KEGG   Pseudonocardia dioxanivorans: Psed_2864Help
Entry
Psed_2864         CDS       T01479                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01130  Biosynthesis of antibiotics
pdx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psed_2864
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psed_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE
Motif
Other DBs
NCBI-ProteinID: AEA25064
JGI: Psed_2864
UniProt: F4CMW5
Position
3028806..3029645
Genome map
AA seq 279 aa AA seqDB search
MGERTKQTSGPTVLESIVAGVREDLAVREAAVDFAEIKRRAAEAPPARDVMAALNAPGVG
VIAEVKRRSPSKGDLASIGDPADLARRYEIGGARVISVLTEQRRFGGSLADLDAVRAAVD
IPILRKDFVVSPYQVHEARAHGADLVLLIVAALEQNVLASLLDRVESLGMTALVEVHTEE
EADRALEAGATLIGVNARNLHTLEVDRGIFGRIAPGLPNNVLRVAESGVRGPGDLLTYAG
WGADAVLVGEGLVTSGDPEGAVRGLVAAGFHPSCSRMVR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcacgaagcagacctccggacccaccgtcctcgaatcgatcgtcgccggt
gtccgcgaggatctcgccgtccgtgaggccgccgtcgacttcgccgagatcaagcgacgt
gccgccgaggcaccgccggcgcgcgacgtgatggccgccctgaacgcccccggcgtcggg
gtgatcgccgaggtcaagcgccgcagcccgtcgaagggcgacctcgcctcgatcggtgat
ccggcggacctcgcgcggcgctacgagatcggtggtgcgcgggtgatcagcgtgctcacc
gagcagcgccgcttcggcggctcgctggccgacctcgacgcggtccgcgcggccgtcgac
atcccgatcctgcgcaaggacttcgtcgtcagcccctaccaggtgcacgaggcgcgggcg
cacggcgcggacctggtcctgctgatcgtcgcggcgctggagcagaacgtcctggcgtcg
ctgctcgaccgggtcgagtccctcgggatgacggcgctggtcgaggtgcacaccgaggag
gaggccgaccgggcgctcgaggccggcgcgacgctgatcggcgtcaacgcccgcaacctg
cacacgctcgaggtcgaccgcgggatcttcgggcggatcgcgccgggcctgcccaacaac
gtgctgcgcgtcgccgagtcgggcgtgcgcgggccgggcgacctgctcacctacgccggg
tggggcgccgatgcggtgctcgtcggcgagggtctggtgaccagcggcgaccccgagggc
gccgtacgtggtctggtggcggcgggcttccacccgtcgtgttcacggatggtgcgctga

DBGET integrated database retrieval system