KEGG   Pseudonocardia dioxanivorans: Psed_2865Help
Entry
Psed_2865         CDS       T01479                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psed_2865
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_2865
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psed_2865
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psed_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3029695..3030993
Genome map
AA seq 432 aa AA seqDB search
MASSTGVKPSDGVANRSGHEPDERGHFGRYGGRFVPEALVAALDELAAAYEKARHDDEFL
GELDRLHRDYTGRPSPLTDAPKLGEHAGGARILLKREDLNHTGSHKINNVLGQALLTKRM
GKKRVIAETGAGQHGVATATACALLDLECVVYMGEVDTARQALNVARMRLLGATVIPVRT
GSRTLKDAINEALRDWVTNVDSTHYLLGTVAGPHPFPVMVRDFHRVIGMEAREQVLERTG
RLPDVVAACVGGGSNAIGIFHAFIDDPSVRLIGFEPGGDGIETGRHGATLAEGSPGALHG
AMSYLLQDEDGQTSESYSISAGLDYPGVGPEHALLKDIGRAEYQPVTDAEAMEAFALLSR
TEGIIPAIESAHAVAGAVRLGRELGPDATILVNVSGRGDKDVDTAAKWFGMIAEGESAED
ADGTAIADGGRA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcagcacgggcgtgaagcccagcgacggtgtcgcgaacaggtcgggacacgag
cccgacgagcgcggccacttcggccgctacggcggcaggttcgtgccggaggcgctcgtc
gccgccctcgacgagctggccgcggcctacgagaaggcccgccacgacgacgagttcctc
ggcgagctcgaccggctgcaccgcgactacacgggccgtccctcgccgctgaccgatgcg
cccaagctcggcgagcacgccggcggcgcccggatcctgctcaagcgcgaggacctcaac
cacaccggctcgcacaagatcaacaatgtcctgggccaggcgctgctcaccaagcggatg
ggcaagaagcgggtcatcgccgagaccggcgccggccagcacggcgtcgcgacggccacc
gcgtgcgcgctgctcgacctcgagtgcgtcgtctacatgggcgaggtcgacaccgcccgg
caggcgctcaacgtcgcccggatgcggctgctcggcgccacggtcatcccggtccgcacc
ggttcccgcaccctcaaggacgccatcaacgaggcgctgcgcgactgggtcaccaacgtc
gactccacgcactacctgctgggcaccgtcgccgggccgcacccgttcccggtgatggtc
cgcgacttccaccgcgtcatcggcatggaggcgcgcgagcaggtgctcgagcgcaccggt
cggctgcccgacgtcgtcgccgcctgcgtcggcggcggatccaacgccatcggcatcttc
cacgcgttcatcgacgacccgtcggtgcgcctcatcggtttcgagccgggcggcgacggg
atcgagaccggccgccacggcgccaccctggccgagggctcgcccggggcgctgcacggt
gcgatgtcgtacctgttgcaggacgaggacggccagacctcggagtcctactccatctcc
gccgggctcgactaccccggcgtcggtcccgagcacgcgctgctcaaggacatcggccgt
gccgagtaccagccggtcaccgacgccgaggcgatggaggcgttcgcgctgctgtcgcgc
accgaggggatcatcccggcgatcgagtcggcgcacgccgtcgccggggcggtccggctc
ggccgcgagctcggccccgacgccacgatcctggtcaacgtctccggacgcggggacaag
gacgtcgacaccgccgcgaagtggttcggcatgatcgccgagggcgagagcgccgaggac
gccgacggcaccgcgatcgccgacggaggacgggcatga

DBGET integrated database retrieval system