KEGG   Pseudonocardia dioxanivorans: Psed_2865Help
Entry
Psed_2865         CDS       T01479                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00260  Glycine, serine and threonine metabolism
pdx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01130  Biosynthesis of antibiotics
pdx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psed_2865
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psed_2865
Enzymes [BR:pdx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psed_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEA25065
JGI: Psed_2865
UniProt: F4CMW6
Position
3029695..3030993
Genome map
AA seq 432 aa AA seqDB search
MASSTGVKPSDGVANRSGHEPDERGHFGRYGGRFVPEALVAALDELAAAYEKARHDDEFL
GELDRLHRDYTGRPSPLTDAPKLGEHAGGARILLKREDLNHTGSHKINNVLGQALLTKRM
GKKRVIAETGAGQHGVATATACALLDLECVVYMGEVDTARQALNVARMRLLGATVIPVRT
GSRTLKDAINEALRDWVTNVDSTHYLLGTVAGPHPFPVMVRDFHRVIGMEAREQVLERTG
RLPDVVAACVGGGSNAIGIFHAFIDDPSVRLIGFEPGGDGIETGRHGATLAEGSPGALHG
AMSYLLQDEDGQTSESYSISAGLDYPGVGPEHALLKDIGRAEYQPVTDAEAMEAFALLSR
TEGIIPAIESAHAVAGAVRLGRELGPDATILVNVSGRGDKDVDTAAKWFGMIAEGESAED
ADGTAIADGGRA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcagcacgggcgtgaagcccagcgacggtgtcgcgaacaggtcgggacacgag
cccgacgagcgcggccacttcggccgctacggcggcaggttcgtgccggaggcgctcgtc
gccgccctcgacgagctggccgcggcctacgagaaggcccgccacgacgacgagttcctc
ggcgagctcgaccggctgcaccgcgactacacgggccgtccctcgccgctgaccgatgcg
cccaagctcggcgagcacgccggcggcgcccggatcctgctcaagcgcgaggacctcaac
cacaccggctcgcacaagatcaacaatgtcctgggccaggcgctgctcaccaagcggatg
ggcaagaagcgggtcatcgccgagaccggcgccggccagcacggcgtcgcgacggccacc
gcgtgcgcgctgctcgacctcgagtgcgtcgtctacatgggcgaggtcgacaccgcccgg
caggcgctcaacgtcgcccggatgcggctgctcggcgccacggtcatcccggtccgcacc
ggttcccgcaccctcaaggacgccatcaacgaggcgctgcgcgactgggtcaccaacgtc
gactccacgcactacctgctgggcaccgtcgccgggccgcacccgttcccggtgatggtc
cgcgacttccaccgcgtcatcggcatggaggcgcgcgagcaggtgctcgagcgcaccggt
cggctgcccgacgtcgtcgccgcctgcgtcggcggcggatccaacgccatcggcatcttc
cacgcgttcatcgacgacccgtcggtgcgcctcatcggtttcgagccgggcggcgacggg
atcgagaccggccgccacggcgccaccctggccgagggctcgcccggggcgctgcacggt
gcgatgtcgtacctgttgcaggacgaggacggccagacctcggagtcctactccatctcc
gccgggctcgactaccccggcgtcggtcccgagcacgcgctgctcaaggacatcggccgt
gccgagtaccagccggtcaccgacgccgaggcgatggaggcgttcgcgctgctgtcgcgc
accgaggggatcatcccggcgatcgagtcggcgcacgccgtcgccggggcggtccggctc
ggccgcgagctcggccccgacgccacgatcctggtcaacgtctccggacgcggggacaag
gacgtcgacaccgccgcgaagtggttcggcatgatcgccgagggcgagagcgccgaggac
gccgacggcaccgcgatcgccgacggaggacgggcatga

DBGET integrated database retrieval system