KEGG   Pseudonocardia dioxanivorans: Psed_2895Help
Entry
Psed_2895         CDS       T01479                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pdx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3064881..3066335
Genome map
AA seq 484 aa AA seqDB search
MAEHVPRPTHGTRPTPGTGPTVAVVGGGISGLATAHRLRTLLGDAARIVVCERSGRIGGV
LHTVDLAGVAVDVGAEAFLARRPEVPALLAELGLADVVVHPTRAAASIRAGGRTGPLPAG
TLMGVPTSAARLDGVLSAAGLAAVAAEPHRPLHWRPGADVALGGLLRERFGPEIADRVAD
PLLGGVYAGRVDALGVRATVPALAAALDAGASSLTAAADAAAPAPSVAAGPVFGAVRGGY
RVLLDALTAAARPELRLDTTVRTLERTAAGWRLVLGPVPAPEYLDADAVVLAVPAPAVRR
LLAEAVPAAAAAAARIELASSVVVAMAYRAADVAALPPTSGVLVAADEPLSIKAATHTST
KWGHLAPDATDGHYRLRTSLGRFGEAHTLQVDDETLVDRARADLATLHTITAAPVAVHVQ
RWGGGLPQYGVGHVGTVAALEAAVAAAPRLAVAGAALHGVGVPACIGTARAAADHVASAL
AVLR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcacgtcccgcgcccgacgcacggcacccgcccgacgccgggcaccggcccg
accgtcgcggtcgtcggcgggggcatctccgggctcgccacggcccaccggttgcgcacg
ctgctcggcgacgcggcgcggatcgtcgtctgcgagcgctcggggcgcatcgggggcgtg
ctgcacaccgtcgacctcgccggggtggccgtcgacgtcggcgccgaggccttcctcgcc
cgccggcccgaggtgccggcactgctcgccgagctcgggctcgccgacgtcgtcgtgcac
ccgaccagggccgcggcgtcgatccgcgcgggcgggcgcaccggcccgctccccgccggc
accctgatgggcgtcccgaccagcgccgcacgtctcgacggcgtgctgtcggccgcgggc
ctggccgccgtcgccgccgagccgcaccggccgctgcactggcggccgggcgccgacgtc
gccctcggcgggctgctccgcgagcggttcggccccgagatcgccgaccgcgtcgccgat
cccctgctcggcggggtctacgcgggccgggtcgacgcgctcggcgtgcgcgccaccgtc
cccgcgctcgcggcggcgctcgacgcgggcgcctcgtcgctgaccgcggcggcggacgcc
gccgcgccggccccgtcggtcgcggcggggcccgtcttcggcgcggtccggggcggctac
cgggtcctgctcgacgcgctgaccgccgccgcccggccggagctgcggctggacacgacc
gtccgcaccctcgagcggacggcggccgggtggcgcctcgtcctcggccccgtccccgcc
cccgagtacctcgacgccgacgccgtggtgctcgccgtgcccgcgcccgccgtccgcagg
ttgctcgccgaggccgtgcccgccgcggcggccgccgccgcgcggatcgagctggcctcg
tcggtcgtcgtcgcgatggcctaccgggccgccgacgtcgccgccctgccgccgacctcg
ggcgtcctcgtcgcggccgacgagccgctgtcgatcaaggcggcgacccacacgtcgacg
aagtggggccatctcgcccccgacgccaccgacgggcactaccggctgcgcacctccctc
ggccggttcggcgaggcgcacacgctgcaggtcgacgacgagaccctcgtcgaccgggcg
cgcgccgacctcgccacgctgcacacgatcacggccgcaccggtcgcggtccacgtccag
cgctggggcggcgggttgccccagtacggcgtcggacacgtcgggacggtcgccgcgctc
gaggccgccgtcgccgcggcgccgcggctcgccgtcgcgggagcggccctgcacggggtc
ggggtgccggcctgcatcggcaccgcgcgcgccgcagccgaccacgtcgcgagcgcgctc
gccgtcctccggtga

DBGET integrated database retrieval system