KEGG   Pseudonocardia dioxanivorans: Psed_3077Help
Entry
Psed_3077         CDS       T01479                                 

Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pdx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdx00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pdx00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pdx00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3283903..3285249
Genome map
AA seq 448 aa AA seqDB search
MSTQIFTLPDLGEGLTEAELVRWLVEVGDTVAVDAPVAEVETAKATVEVPSPFGGVIAEL
HGEEGATLSVGAPLISVTTESVSRAAQTYVEEERAGSGNVLIGYGTSEAAPSRRRRTGSA
TPATATATATATATNGPGRRPAGERPPVISPIVRQLARRAGVDLTTLAGTGPNGLITRRD
VESAVAAQTTVTASESRAAQPQQSPRAEDGVDRRTGLPIRTRVPLTGLRKAVTETLSRSR
SEIPEATTWVDVDATALLDLRAQLELNATGRAPGVLAMVARFVVAGLARHPELNARVDTE
RGEVVHLDGVNLGLAAQTDRGLVVPAVSDAHRLTMRGLDAEIRRLTTAAREGTATAAELT
SGSFTLNNYGVLGVDGSAAIINHPEVAILGLGRIIARPWVVDDAIVVRQIVQLSLVFDHR
VCDGGTAGGFLRFVADAIESPTSALADL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgcagatcttcacccttcccgacctgggggaggggctcaccgaggccgagctg
gtccggtggctggtcgaggtcggcgacacggtcgcggtcgacgcacccgtggccgaggtc
gagacagcgaaggcgacggtcgaagtgccctcgccgttcgggggcgtgatcgcagagctg
cacggtgaggagggcgccacgctgagcgtcggcgcgccgctgatctccgtcaccaccgag
agcgtgtcgagggccgcgcagacctatgtggaagaggagcgagccgggtcgggcaacgtc
ctgatcgggtacggcacgtccgaggccgccccgtcgcggcgtcggcgcacgggctcggca
acgcccgccaccgccaccgccaccgccaccgccaccgccaccaacggacccgggcgccgc
cccgcgggcgagcgacccccggtgatctcgccgatcgtgcgccaactcgcccgtcgtgcg
ggcgtggacctcaccacgctggccgggacgggcccgaacgggctgatcacccgccgggac
gtcgagtccgccgttgcggcgcaaacgaccgtcacggcgagtgagtcccgcgccgcgcag
ccgcagcagtcaccgagggccgaggacggcgtggaccgccggaccgggctgccgatccgc
acccgggtgccgctcacgggcctacgcaaggccgtcaccgagacgctgtcgcgcagccgt
tcggagatccccgaggccaccacctgggtggacgtggatgcgacggcgctgctggatctg
cgcgcacagctcgagctcaacgcgaccggccgggcgccaggcgtcctggcgatggtcgcg
cggttcgtggtggccggtctggcccggcaccccgagctcaacgcgcgggtggacaccgag
cgcggcgaggtcgtccacctcgacggcgtcaacctcggcctggccgcccagaccgaccgt
ggcctcgtggttccggccgtctccgatgcgcaccgcctgaccatgcgcggtctcgacgcc
gagatccgcaggctgaccacggcggcccgcgaggggaccgcgaccgcggccgagctgacc
tccggctcgttcaccctgaacaactacggcgtgctcggggtcgacggcagcgctgcgatc
atcaaccatcccgaggtcgccatcctcggcctgggccgcatcatcgcacggccctgggtg
gtcgacgacgcgatcgtcgtccggcagatcgtccagctgtcgctggtgttcgaccaccgg
gtgtgcgacggcggcacggcgggcgggttcctgcgcttcgtcgccgacgccatcgagtcc
ccgacctcggcacttgccgacctgtga

DBGET integrated database retrieval system