KEGG   Pseudonocardia dioxanivorans: Psed_3335Help
Entry
Psed_3335         CDS       T01479                                 

Definition
(GenBank) Mg-chelatase subunit ChlI-like protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00860  Porphyrin and chlorophyll metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psed_3335
Enzymes [BR:pdx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Psed_3335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3 AAA_PrkA MCM ABC_tran NACHT AAA_16
Motif
Other DBs
NCBI-ProteinID: AEA25525
JGI: Psed_3335
UniProt: F4CX84
Position
complement(3561830..3563230)
Genome map
AA seq 466 aa AA seqDB search
MPVTPPSDLPDTLAALRASGHVQRGVKAEIRENLLAALREGRDPWPGIVGFESTVLPQLE
RALLAGHDVVLLGERGQGKTRLLRSLTGLLDEWTPVIAGSELGEHPYEPIAPESVRRAAE
LGDALPVAWRHRSERYTEKLATPDTAVADLIGDVDPVKVAEGRSLGDPETIHFGLVPRAH
RGVVAINELPDLAERIQVALLNVMEERDIQVRGYTLRLPLDVLLVASANPEDYTNRGRII
TPLKDRFGAEVRTHYPLEVADEVALVEQEAELVADVPRHLIEVVARFTRHLREASAVDQA
SGVSARFAVAAAETVAAAALRRAAITGESRAVARPVDLDSVPAVLRGKLEFASGEEGREE
EILEHLLRRATADTARFALRGVDLSELTDAVGTRPVRTGERVPAAEVVAALPQVPALTEV
ATRLGASGTEDPGPMASAAELALEYLFLTRKLAKDESDDGDTVSYG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtcacaccaccttccgatcttcccgacaccctcgccgcgctgcgggcctccggc
cacgtgcagcgcggcgtcaaggccgagatccgcgagaacctcctcgccgcgctgcgcgag
ggccgtgacccctggcccggcatcgtcggcttcgagtcgaccgtcctcccgcagctcgaa
cgcgccctgctcgccgggcacgacgtcgtgctgctcggcgaacgcggccagggcaagacc
cgcctgcttcgctcgctgaccggtctgctcgacgagtggacccccgtcatcgccggctcc
gagctgggcgagcacccctacgagcccatcgccccggagtcggtgcgtcgcgccgccgag
ctgggcgacgcgcttcccgtcgcatggcgacaccgctcggagcgctacaccgagaagctc
gcgacgcccgacaccgccgtcgccgacctgatcggcgacgtcgaccccgtcaaggtcgcc
gagggccgctccctcggcgacccggagaccatccacttcgggctggtcccgcgcgcgcac
cggggcgtcgtcgcgatcaacgagctgcccgacctcgccgagcgcatccaggtcgcgctg
ctcaacgtcatggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctc
gacgtcctgctggtcgcgtccgcgaacccggaggactacaccaaccgcgggcggatcatc
accccgctcaaggaccgtttcggcgccgaggtccgcacgcactacccgctcgaggtggcc
gacgaggtcgcgctcgtggagcaggaggccgagctggtcgccgacgtgccacgccacctg
atcgaggtcgtcgcccggttcacccggcacctgcgcgaggcctccgcggtcgaccaggcc
tccggcgtctcggcccggttcgcggtcgccgccgccgagaccgtcgcggccgcggcgctg
cgccgtgcggcgatcacgggggagtcccgcgccgtcgcccggccggtcgacctcgactcg
gtcccggcggtgctgcgcggcaagctggagttcgcgtccggcgaggaggggcgcgaggag
gagatcctcgagcacctgctgcgccgcgccaccgccgacaccgcacggttcgcgctgcgc
ggcgtggacctgtccgagctgaccgacgccgtcggcacccgcccggtccgcaccggcgaa
cgtgtcccggccgccgaggtcgtggcggcgttgccgcaggtcccggcgctcaccgaggtc
gcgacccggctcggggcgtccggcaccgaggacccgggaccgatggcctcggccgcggag
ctggcgctggagtacctgttcctgacgcgcaagctcgccaaggacgagtccgacgacgga
gacacggtcagctatggctga

DBGET integrated database retrieval system