KEGG   Pseudonocardia dioxanivorans: Psed_3417Help
Entry
Psed_3417         CDS       T01479                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_3417
   01230 Biosynthesis of amino acids
    Psed_3417
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_3417
   00051 Fructose and mannose metabolism
    Psed_3417
   00562 Inositol phosphate metabolism
    Psed_3417
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Psed_3417
Enzymes [BR:pdx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Psed_3417
Exosome [BR:pdx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Psed_3417
  Exosomal proteins of bladder cancer cells
   Psed_3417
  Exosomal proteins of melanoma cells
   Psed_3417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3653736..3654548)
Genome map
AA seq 270 aa AA seqDB search
MTPSAGTPTSGRKPLIAGNWKMNLTHLEAIAFLQKLAYGLPEKYYAKVEVAVLPPFTAIR
SVQTVIDGDGLLMTHGAQDISPHESGAYTGDVSGPMLAKLMCRYVVVGHSERRAYHHEDD
AVVNAKVRAAFASGITPILCVGEGLDVREAGEHVGHCTTQLSAALEKVTPEQAATLVVAY
EPIWAIGTGRVAGAGDAQEVCAAVRGTLGKLYGDTVAGSARVLYGGSVKSGNVGEIVAEP
DVDGALVGGASLDPDEFAKLCAIAAGGPLP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgtccgctgggaccccgacgagcggccgcaagccgctcatcgccggcaactgg
aagatgaacctcacacacctcgaggccatcgccttcctgcagaagctcgcctacgggctg
ccggagaagtactacgccaaggtcgaggtggcggtgctcccgccgttcaccgcgatccgc
agcgtccagaccgtgatcgacggcgacgggctgctgatgacccacggcgcgcaggacatc
tcgccccacgagtccggtgcctacaccggggacgtctcgggtccgatgctggccaagctc
atgtgccgctacgtcgtcgtcgggcactccgagcggcgcgcgtaccaccacgaggacgat
gcggtcgtcaacgcgaaggtgcgcgcggcgttcgccagcggcatcacgcccatcctgtgt
gtcggggagggactcgacgtgcgcgaggccggcgagcacgtcggccactgcacgacgcag
ctcagcgccgcgctcgagaaggtcacccccgagcaggcggcgacgctcgtcgtcgcgtac
gagccgatctgggcgatcggcacgggccgggtcgccggcgcgggcgacgcccaggaggtg
tgtgccgccgtgcgcggcacgctcgggaagctctacggcgacaccgtggccgggtccgcg
cgcgtgctctacggcggctcggtgaagtcgggcaacgtcggcgagatcgtggccgagccc
gacgtcgacggcgcgctggtcggcggggcgagcctcgaccccgacgagttcgccaagctg
tgcgcgatcgccgcgggcggcccgctgccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system