KEGG   Pseudonocardia dioxanivorans: Psed_3417Help
Entry
Psed_3417         CDS       T01479                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00010  Glycolysis / Gluconeogenesis
pdx00051  Fructose and mannose metabolism
pdx00562  Inositol phosphate metabolism
pdx00710  Carbon fixation in photosynthetic organisms
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
pdx01230  Biosynthesis of amino acids
Module
pdx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pdx_M00002  Glycolysis, core module involving three-carbon compounds
pdx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_3417
   00051 Fructose and mannose metabolism
    Psed_3417
   00562 Inositol phosphate metabolism
    Psed_3417
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Psed_3417
Enzymes [BR:pdx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Psed_3417
Exosome [BR:pdx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Psed_3417
  Exosomal proteins of bladder cancer cells
   Psed_3417
  Exosomal proteins of melanoma cells
   Psed_3417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEA25606
JGI: Psed_3417
UniProt: F4CYG6
Position
complement(3653736..3654548)
Genome map
AA seq 270 aa AA seqDB search
MTPSAGTPTSGRKPLIAGNWKMNLTHLEAIAFLQKLAYGLPEKYYAKVEVAVLPPFTAIR
SVQTVIDGDGLLMTHGAQDISPHESGAYTGDVSGPMLAKLMCRYVVVGHSERRAYHHEDD
AVVNAKVRAAFASGITPILCVGEGLDVREAGEHVGHCTTQLSAALEKVTPEQAATLVVAY
EPIWAIGTGRVAGAGDAQEVCAAVRGTLGKLYGDTVAGSARVLYGGSVKSGNVGEIVAEP
DVDGALVGGASLDPDEFAKLCAIAAGGPLP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgtccgctgggaccccgacgagcggccgcaagccgctcatcgccggcaactgg
aagatgaacctcacacacctcgaggccatcgccttcctgcagaagctcgcctacgggctg
ccggagaagtactacgccaaggtcgaggtggcggtgctcccgccgttcaccgcgatccgc
agcgtccagaccgtgatcgacggcgacgggctgctgatgacccacggcgcgcaggacatc
tcgccccacgagtccggtgcctacaccggggacgtctcgggtccgatgctggccaagctc
atgtgccgctacgtcgtcgtcgggcactccgagcggcgcgcgtaccaccacgaggacgat
gcggtcgtcaacgcgaaggtgcgcgcggcgttcgccagcggcatcacgcccatcctgtgt
gtcggggagggactcgacgtgcgcgaggccggcgagcacgtcggccactgcacgacgcag
ctcagcgccgcgctcgagaaggtcacccccgagcaggcggcgacgctcgtcgtcgcgtac
gagccgatctgggcgatcggcacgggccgggtcgccggcgcgggcgacgcccaggaggtg
tgtgccgccgtgcgcggcacgctcgggaagctctacggcgacaccgtggccgggtccgcg
cgcgtgctctacggcggctcggtgaagtcgggcaacgtcggcgagatcgtggccgagccc
gacgtcgacggcgcgctggtcggcggggcgagcctcgaccccgacgagttcgccaagctg
tgcgcgatcgccgcgggcggcccgctgccctga

DBGET integrated database retrieval system