KEGG   Pseudonocardia dioxanivorans: Psed_3520Help
Entry
Psed_3520         CDS       T01479                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00230  Purine metabolism
pdx01100  Metabolic pathways
Module
pdx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Psed_3520
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Psed_3520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase AAA_22 AAA_25 MMR_HSR1 AAA_33 AAA_5 AAA_17 AAA_29 Cytidylate_kin AAA_28 AAA_30 ABC_tran AAA_24 Zeta_toxin NTPase_1 RNA_helicase AAA PRK
Motif
Other DBs
NCBI-ProteinID: AEA25693
JGI: Psed_3520
UniProt: F4CZG2
Position
complement(3759934..3760596)
Genome map
AA seq 220 aa AA seqDB search
MNGAPEPAGGAERSPRGRLIVLAGPSGVGKSSVVAQLRERLPELHFSVSATTRAPRVGEV
DGRDYRFVSPAEFDGLIERGELLEWAEIHGGLQRSGTPAAEVERARAEGRPVLVEVDLQG
ARAVKKAVPEAVTVFLDPPSFDELARRLGSRGTESAAQLARRLETAREELAARDEFDVVV
VNDDVRRVVDRLVQLAVSRTPPRGGARGSDDDLSPQESFQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggcgcccccgaacccgccggtggggctgaacgatccccgagaggccggctgatc
gtgttggccggcccctcgggggtcgggaagagcagtgtggtcgcgcagctgcgcgagcgg
ctccccgagctgcacttcagcgtctcggcgacgacgcgggccccgcgcgtgggcgaggtc
gacggccgggactaccggttcgtttcccctgcggagttcgacggtctcatcgagcgcggc
gagctgctggagtgggccgagatccacggcggcctccagcgctcgggcacgccggcggcc
gaggtcgagcgggcccgcgccgagggcaggccggtcctcgtcgaggtcgacctgcagggg
gcccgggcggtcaagaaggccgtgccggaggcggtgaccgtcttcctcgaccccccgtcg
ttcgacgagctggcgcgccggctcggcagccgcgggaccgagtcggccgcgcagctggcc
cgccggctggagaccgcccgcgaggagctcgccgcccgcgacgagttcgacgtcgtggtc
gtcaacgacgacgtgcggcgcgtcgtcgaccggttggtacagttggcggtcagccgcacg
ccgccacggggcggggcccgcggcagtgacgacgatctctccccgcaggagtcctttcag
tga

DBGET integrated database retrieval system