KEGG   Pseudonocardia dioxanivorans: Psed_3527Help
Entry
Psed_3527         CDS       T01479                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00240  Pyrimidine metabolism
pdx00250  Alanine, aspartate and glutamate metabolism
pdx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Psed_3527
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psed_3527
Enzymes [BR:pdx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Psed_3527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEA25700
JGI: Psed_3527
UniProt: F4D044
Position
complement(3769181..3770125)
Genome map
AA seq 314 aa AA seqDB search
MKHLLTVTDLDAATATALLDTSDRLRQALLGREVRKLPTLRGRTVITMFYEDSTRTRVSF
EIAGKWMSADTVNVSAKGSSVSKGESLRDTSLTLSAMGADCVIVRHPASGAAHRLAAWAD
KDRESTGTHTSIVNAGDGTHEHPTQALLDAATLRDRLGSVAGRRIGIVGDVLHSRVARSN
VFLLATLGAEVVLIAPPTLLPVGVAEWPCRVSHEIDAELPGLDAVMMLRVQAERMTGGFF
PSSREYAVAYGLSDARAAMLPEHGVVLHPGPMVRGMEIAPSVADSARAAILAQVRNGVHV
RMAVLYHLLAGAPE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcacctgctcaccgtcaccgacctcgacgcggccaccgcgaccgccctgctcgac
acgtccgaccggctgcgccaggcgctgctcggccgcgaggtgcgcaagctccccacgctg
cgcgggcgcaccgtcatcacgatgttctacgaggactcgacccgcacccgggtctcgttc
gagatcgccggcaagtggatgagcgccgacacggtcaacgtcagcgccaagggctcgtcg
gtctccaagggcgagtcgctgcgcgacacgtcgctcacgctctcggcgatgggggccgac
tgcgtgatcgtccggcacccggcgtccggtgcggcgcaccggctcgcggcctgggccgac
aaggaccgcgagtccaccggcacgcacacctccatcgtcaacgccggcgacgggacccac
gagcacccgacgcaggcgctgctcgacgcggccaccctgcgcgaccggctcgggtcggtg
gcggggcggcggatcggcatcgtcggcgacgtcctgcacagccgcgtcgcccgctccaac
gtcttcctgctggccacgctcggcgccgaggtcgtgctgatcgcgccgccgacgctgctg
ccggtcggggtcgccgagtggccctgccgggtctcccacgagatcgacgccgagctcccg
ggcctcgacgcggtgatgatgctgcgcgtccaggccgaacgcatgaccggcgggttcttc
ccgtcgtcgcgcgagtacgccgtcgcctacggcctctccgacgcccgcgcggcgatgctc
cccgagcacggcgtcgtgctgcaccccggaccgatggtgcgcggcatggagatcgcgccg
agcgtggccgactcggcccgcgccgcgatcctcgcgcaggtccgcaacggcgtccacgtg
cggatggccgtcctctaccaccttctcgcgggagccccggagtga

DBGET integrated database retrieval system