KEGG   Pseudonocardia dioxanivorans: Psed_3648Help
Entry
Psed_3648         CDS       T01479                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_3648
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_3648
   00520 Amino sugar and nucleotide sugar metabolism
    Psed_3648
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Psed_3648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3906019..3906789
Genome map
AA seq 256 aa AA seqDB search
MSGKSEKSKHDKHIGFGIDIGGSGIKGAPVDLRKGELTDDRLRIPTPQPATPDAVAEVVT
KVLDHFGWDREFGCTLPAVVQHGVVRTAANIDHSWIGTDAHELMKNATGRKALVVNDADA
AGVAEVRFGAAKGNSGVVLVSTLGTGIGSALVIDGKLWPNTELGHLEIDGYDAEKRAADS
AREREDLDWDGWAERLTRYYGVVESLLRPDLIVVGGGVSKKSAKWMSKVDIHTKMVPAEL
LNEAGIIGAAVLAAGH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaagtcggagaagtccaagcacgacaagcacatcgggttcggcatcgacatc
ggcggctcgggcatcaagggcgcaccggtcgacctgcgcaagggcgagctgaccgacgac
cggctgcgcatcccgaccccgcagccggcgacgcccgacgccgtcgccgaggtcgtcacc
aaggtgctcgaccacttcggctgggaccgcgagttcggctgcaccctgccggcggtcgtg
cagcacggcgtcgtgcggaccgcggccaacatcgaccacagctggatcggcaccgacgcc
cacgagctgatgaagaacgccaccggccgcaaggcgctcgtcgtcaacgacgccgacgcc
gccggcgtggccgaggtccggttcggcgccgccaagggcaactccggtgtcgtcctcgtc
agcacgctcggcaccgggatcggatcggcgctggtcatcgacggcaagctctggcccaac
accgagctgggccacctggagatcgacgggtacgacgcggagaagcgcgccgccgactcc
gcccgcgagcgcgaggacctcgactgggacggctgggccgagcggctcacccgctactac
ggcgtcgtcgagtcgctgctgcggcccgatctgatcgtcgtcggcggcggcgtgagcaag
aagtccgcgaagtggatgtcgaaggtggacatccacacgaagatggtgcccgccgagctg
ctcaacgaggcagggatcatcggcgcggcggtgctggccgccggtcactga

DBGET integrated database retrieval system