KEGG   Pseudonocardia dioxanivorans: Psed_3648Help
Entry
Psed_3648         CDS       T01479                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00010  Glycolysis / Gluconeogenesis
pdx00520  Amino sugar and nucleotide sugar metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
Module
pdx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pdx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_3648
   00520 Amino sugar and nucleotide sugar metabolism
    Psed_3648
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Psed_3648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEA25819
JGI: Psed_3648
UniProt: F4D0W7
Position
3906019..3906789
Genome map
AA seq 256 aa AA seqDB search
MSGKSEKSKHDKHIGFGIDIGGSGIKGAPVDLRKGELTDDRLRIPTPQPATPDAVAEVVT
KVLDHFGWDREFGCTLPAVVQHGVVRTAANIDHSWIGTDAHELMKNATGRKALVVNDADA
AGVAEVRFGAAKGNSGVVLVSTLGTGIGSALVIDGKLWPNTELGHLEIDGYDAEKRAADS
AREREDLDWDGWAERLTRYYGVVESLLRPDLIVVGGGVSKKSAKWMSKVDIHTKMVPAEL
LNEAGIIGAAVLAAGH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaagtcggagaagtccaagcacgacaagcacatcgggttcggcatcgacatc
ggcggctcgggcatcaagggcgcaccggtcgacctgcgcaagggcgagctgaccgacgac
cggctgcgcatcccgaccccgcagccggcgacgcccgacgccgtcgccgaggtcgtcacc
aaggtgctcgaccacttcggctgggaccgcgagttcggctgcaccctgccggcggtcgtg
cagcacggcgtcgtgcggaccgcggccaacatcgaccacagctggatcggcaccgacgcc
cacgagctgatgaagaacgccaccggccgcaaggcgctcgtcgtcaacgacgccgacgcc
gccggcgtggccgaggtccggttcggcgccgccaagggcaactccggtgtcgtcctcgtc
agcacgctcggcaccgggatcggatcggcgctggtcatcgacggcaagctctggcccaac
accgagctgggccacctggagatcgacgggtacgacgcggagaagcgcgccgccgactcc
gcccgcgagcgcgaggacctcgactgggacggctgggccgagcggctcacccgctactac
ggcgtcgtcgagtcgctgctgcggcccgatctgatcgtcgtcggcggcggcgtgagcaag
aagtccgcgaagtggatgtcgaaggtggacatccacacgaagatggtgcccgccgagctg
ctcaacgaggcagggatcatcggcgcggcggtgctggccgccggtcactga

DBGET integrated database retrieval system