KEGG   Pseudonocardia dioxanivorans: Psed_3679Help
Entry
Psed_3679         CDS       T01479                                 

Definition
Dimethylallyltranstransferase (EC:2.5.1.1)
Orthology
K13787  
geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pdx00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3933821..3934891
Genome map
AA seq 356 aa AA seqDB search
MTATLGSRAVPGSPDHGAGHREVATAVLRRGRDTVTPALQAAVDRLDDASRTQARYHLGW
TKLDGSPGAGGGKAVRPALALLSAAAAGAGVEVGVPGAVAVELVHNFSLLHDDLMDGDTE
RRHRTTVWVQWGASSAILCGDAMLALAQEVLLEAPSPHAAPAARLLAVTTRELIRGQAED
LAFESRDDVGVDECLSMAAGKTGSLLAASASIGAVLAGAPAAQTEALHTYGHEVGMAFQL
VDDLLGIWGDPGVTGKPVLSDLRSRKKSLPVTYAIRNGGDIGRELGDWLAADGDPTDDEL
HAAARLVEQGGGREWAAAEARRRRDRALDAVTGAGLLPGPTAELVAVAHHLVDREF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacactgggcagccgggcggtgcccgggtccccggaccacggtgccggccac
cgggaggtggcgaccgcggtgctgcggcgcggccgcgacaccgtcaccccggcgctgcag
gccgccgtcgaccgcctcgacgacgccagccgcacccaggcccgctaccacctcggctgg
accaagctcgacgggtcacccggcgcgggcggcggcaaggccgtccggcccgcgctcgcg
ctgctctcggccgccgcggccggtgccggggtcgaggtgggcgtaccgggagcggtcgcc
gtcgagctggtgcacaacttctcgctgctgcacgacgacctgatggacggcgacaccgaa
cgccggcaccgcacgacggtgtgggtgcagtggggcgcgtcgtcggcgatcctgtgcggc
gacgcgatgctggcgctcgcgcaggaggtgctgctcgaggcgccgtcgccgcacgcggcg
ccggccgcccggctgctcgccgtcaccacccgggagctgatccgcggccaggccgaggac
ctcgcgttcgagtcgcgcgacgacgtcggggtcgacgagtgcctgtcgatggccgcgggc
aagacggggtcgctgctcgcggcgagcgcgtcgatcggcgcggtgctcgcgggcgccccg
gccgcgcagaccgaggcgctgcacacctacggccacgaggtcgggatggcgttccagctg
gtcgacgacctgctcggaatctggggcgacccgggcgtcaccggcaagccggtgctgtcg
gacctgcggtcgcgcaagaagtcgctgccggtcacctacgcgatccgcaacggcggggac
atcggccgcgagctcggcgactggctcgccgccgacggcgacccgaccgacgacgagctg
cacgccgcggcgcggctcgtcgaacagggcggcggccgcgagtgggccgccgccgaggcc
cgccgccgccgcgaccgcgcactcgacgccgtgaccggcgccgggctcctccccggcccc
acggccgagctcgtcgccgtcgcacaccacctcgtcgacagggagttctga

DBGET integrated database retrieval system