KEGG   Pseudonocardia dioxanivorans: Psed_4016Help
Entry
Psed_4016         CDS       T01479                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psed_4016
Enzymes [BR:pdx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Psed_4016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4318678..4320843
Genome map
AA seq 721 aa AA seqDB search
MTAAVTTTGNGPGTATGSAAAGTAAGTAAGPVPIGPVAPGGDPYDPRYARGAGGLLARFN
AAGVLAAADVHVAARLGRLGGETDETVLLAAALTVRALRHGSVCVDLDEVGTTVLGEGDE
VLDVSALPWPDPAAWRAACLASPLVSAEPTGGVAPLRMPHGLLYLDRYWRQEEQVRVELR
ARAAAEPPRVDVDRLRAGLSRLFTDAADGRTDADDRTDGAGAATGDADARAGGGAGPDAG
TGTDLVAGVGERPGAVARAGTAADAAAAAGETDRQRLAAAVATLRRVTVVAGGPGTGKTT
TVARLLALLRDQPGPPPRVALAAPTGKAAARLAEAVREQVRRLPGPDRARLGDLPASTLH
RLLGFRPGHTNRFHHDRTNRLPHDVVVVDETSMVSLTMMARLLEAVRPDARLVLVGDPDQ
LASVEAGAVLGDLARAPGPVEPALDATLRELGVLGRADPAVVHGVVTLDRTWRFGAEIAA
LARAVRDGDGDGAIEALRSGAGGAVEFVEAPTLELRDPPGLDAVRAEVVAANRTLVAHAR
AGDVDGALRALDRHRLLCAHRRGPYGVTRWGWEVERWLTDAGVGPGPDDGEWFPGRAVLV
TTNDYDLNLYNGDTGVLVREEGRTRAVFGRGGAPLRVATARLSQPQSVHAMTVHRAQGSQ
FSQVTVVLPAPESPLLTRELLYTAVTRAIERVRVVGSEAAVRAAVARPVGRASGLRDRLA
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgctgtgacgaccaccgggaacggccccgggaccgccacggggtccgccgcc
gccggaaccgccgccgggaccgccgcagggcccgttcccatcgggccggtcgcgccgggc
ggcgacccgtacgacccgcggtacgcccgcggtgccggcgggctgctcgcccgcttcaac
gccgcgggggtgctcgccgcggccgacgtgcacgtcgcggcccggctcgggcggctcggc
ggggagaccgacgagaccgtcctgctcgccgcggcgctgaccgtgcgggccttgcggcac
gggtcggtgtgcgtcgacctcgacgaggtcgggacgacggtgctcggcgagggcgacgag
gtcctcgacgtctcggcgctgccgtggcccgacccggcagcgtggcgggccgcgtgcctg
gccagcccgctggtgtccgccgagcccaccgggggcgtcgcgccgctgcggatgccccac
ggcctgctgtacctcgaccgctactggcggcaggaggagcaggtgcgcgtcgagctgcgc
gcccgcgcggccgccgagccgccccgggtcgacgtcgaccggctgcgggcggggctgtcc
cggctgttcaccgacgccgcggatggccggaccgacgccgatgaccggaccgacggggca
ggtgctgcgaccggcgacgccgacgcgcgcgcaggcggcggtgccggtcccgacgccggg
accggaaccgatctcgtcgccggtgtcggcgaacgtcccggcgcggtcgcgcgggccggt
accgcggcggacgccgccgccgcggccggggagaccgaccggcagcggctggccgccgcc
gtcgccacgctgcgccgggtcaccgtcgtcgcgggcgggcccggcaccggcaagacgacg
accgtcgcccggctgctcgccctgctgcgcgaccagcccggccctccgccgcgcgtcgcg
ctggccgcccccaccggcaaggccgcggcccggctcgcggaggccgtgcgcgaacaggtc
cgccggctgcccgggcccgaccgcgcccggctcggcgacctccccgcctcgacgctgcac
cggctgctcggcttcaggcccggccacaccaaccggttccaccacgaccgcaccaaccgg
ctcccgcacgacgtcgtcgtcgtcgacgagacgtcgatggtgtcgctgacgatgatggcg
cggctgctcgaggccgtgcggcccgacgcccggctcgtcctggtcggcgaccccgaccag
ctggcgtcggtcgaggcgggcgcggtgctgggcgacctggcccgcgccccgggcccggtc
gagcccgccctcgacgcgacgctgcgcgagctcggtgtgctcggccgggccgaccccgcg
gtcgtgcacggcgtcgtcaccctcgaccggacctggcggttcggcgccgagatcgccgcg
ctggcccgggccgtccgcgacggcgacggcgacggcgcgatcgaggcgttgcgctccggg
gcgggcggggccgtcgagttcgtggaggccccgacgttggagctgcgcgacccgcccggt
ctcgacgcggtccgcgccgaggtcgtggccgccaaccggacgctggtggcacacgcgcgg
gcaggcgacgtcgacggggcgctgcgcgcgctcgaccggcaccggctgttgtgcgcccac
cgccgcgggccgtacggggtgacccgctggggctgggaggtcgagcgctggctcaccgac
gccggggtcgggccgggccccgacgacggcgagtggttccccggccgggccgtgctcgtc
accaccaacgactacgacctcaacctctacaacggcgacaccggggtcctcgtccgcgag
gagggccgcacgagggcggtgttcggtcgtggtggcgccccgttgcgggtcgccaccgcc
cggctctcgcagccgcagagcgtccacgcgatgacggtgcaccgggcgcagggcagccag
ttctcgcaggtcacggtcgtgctgccggccccggagtcgccgttgctgacgcgcgagctg
ctctacacggcggtgacccgcgcgatcgagcgggtccgggtcgtcgggtcggaggcggcg
gtgcgggccgcggtcgcacgcccggtcggccgggcgtccgggctgcgcgaccggctcgcc
ggctga

DBGET integrated database retrieval system