KEGG   Pseudonocardia dioxanivorans: Psed_4178Help
Entry
Psed_4178         CDS       T01479                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00360  Phenylalanine metabolism
pdx00362  Benzoate degradation
pdx00620  Pyruvate metabolism
pdx00621  Dioxin degradation
pdx00622  Xylene degradation
pdx00650  Butanoate metabolism
pdx01100  Metabolic pathways
pdx01120  Microbial metabolism in diverse environments
pdx01220  Degradation of aromatic compounds
Module
pdx_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
pdx_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psed_4178
   00650 Butanoate metabolism
    Psed_4178
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Psed_4178
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psed_4178
   00622 Xylene degradation
    Psed_4178
   00621 Dioxin degradation
    Psed_4178
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Psed_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEA26341
JGI: Psed_4178
UniProt: F4CUM7
Position
4502479..4503384
Genome map
AA seq 301 aa AA seqDB search
MDIPKVPVAIVGPGHIGTDLLVKLRRSPVLDVRYVAGIVESEGLARAREAGVAASAGGVD
WLLAQDPLPRIVFEATSAKAHLANAPRYEAAGIRAVDLTPAHLGPMVCPAVNGEDHLDAA
NVSMITCGGQATIPMVAAVSRVTPVPYAEIVASIASRSAGPGTRANIDEFTHTTGGAVAE
VGGAARGKAIIVLNPVEPPMIMRDTVFCMIGADADRAAITASVHDMVLRVQEYVPGYTLR
AEPQFDEPTDEWGGHARVAVFLEVKGNGDHLPPYAGNLDIMTAAAARTGELMARAELGAL
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacatcccgaaggtgccggtcgcgatcgtcggccccggacatatcggcacggacctg
ctggtcaaactccgtcggagcccggtgctcgacgtccgctacgtcgccgggatcgtcgag
tccgagggcctggcccgggcccgcgaggccggcgtggcggcgtcggcgggcggcgtcgac
tggctgctggcccaggacccgctgccgcgcatcgtcttcgaggcgacgtcggccaaggcg
cacctggccaatgcgccgcgctacgaggcggcgggcattcgcgccgtcgacctcaccccg
gcccacctcggcccgatggtctgcccggcggtgaacggcgaggaccacctcgacgcggcg
aacgtctccatgatcacctgcggcgggcaggcgacgatcccgatggtcgcagccgtctcc
cgggtgaccccggtgccctacgccgagatcgtcgcctcgatcgcgtcgcggtcggccgga
ccgggcacccgcgccaatatcgacgagttcacccacaccacaggcggcgccgtcgccgag
gtcggcggggcggcgcgcgggaaggcgatcatcgtcctcaacccggtcgaaccgccgatg
atcatgcgcgacaccgtgttctgcatgatcggtgccgacgccgaccgcgccgcgatcacc
gcgtcggtccacgacatggtcctgcgggtgcaggagtacgtcccgggctacacgctgcgt
gccgagccgcagttcgacgagcccaccgacgagtggggcgggcacgcccgagtcgccgtg
ttcctcgaggtcaagggcaacggcgaccacctgccgccctatgccggaaacctcgacatc
atgaccgcggccgcggcacgcaccggcgagctgatggcccgcgccgagctgggagctctc
gcatga

DBGET integrated database retrieval system