KEGG   Pseudonocardia dioxanivorans: Psed_4402Help
Entry
Psed_4402         CDS       T01479                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_4402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_4402
   00052 Galactose metabolism
    Psed_4402
   00500 Starch and sucrose metabolism
    Psed_4402
   00520 Amino sugar and nucleotide sugar metabolism
    Psed_4402
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psed_4402
   00524 Butirosin and neomycin biosynthesis
    Psed_4402
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psed_4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4729033..4730061
Genome map
AA seq 342 aa AA seqDB search
MRGVTSGHRAPSGRRAIGLDIGGTNIRGAVVADDGTLLAEVSERTPETSDGTTMTKILLG
ITQQLHAQHPEVVAVGVGAAGIVEWPAGLIRWAPNNSYRDWQVRAELEEATGLPATVDND
ANVAALAEARLGRDRYSEMVFLTVGTGVGGGLVLGGVIYRGPSGRGGELGHIIVAPDGPR
CGCGNRGCLEAVASGTALTRMGREAAAAEPAGVIARLGREEEDGVVTGHTVTRATELGDP
TALDLFTRLGRWLGIGIASLANIFEIEAVVIGGGLVATGDLLLDPARAAYREHAYATEAR
PVVPVRVGTFGTDAGVVGAGLLGLEHAEDRRVHAVPPERATR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgtgacgagtggacaccgcgctccgtccgggcgccgcgcgatcggcctcgac
atcggggggaccaacatccgcggcgccgtcgtcgccgacgacgggaccctgctcgccgag
gtctccgaacgcacccccgagacgtccgacggcacgacgatgacgaagatcctgctcggc
atcacccagcagctgcacgcgcagcacccggaggtcgtcgccgtcggggtgggagcggcc
gggatcgtcgagtggccggccgggctgatccggtgggcgcccaacaactcctaccgcgac
tggcaggtccgggccgagctggaggaggccaccgggctgcccgcgaccgtcgacaacgac
gccaacgtcgccgcgctcgccgaggcccgcctcggccgggaccgctactccgagatggtg
ttcctgaccgtcggcaccggcgtcggaggtgggctcgtcctgggcggggtcatctaccgc
ggaccgtccgggcgcggcggcgagctggggcacatcatcgtcgcacccgacggtccccgc
tgcggctgcggcaaccgcggctgcctggaggccgtcgcgtcgggcacggcgctgacccgg
atgggtcgcgaggccgcggcggccgagccggccggcgtgatcgcccggctcggccgcgag
gaggaggacggcgtcgtcaccgggcacaccgtcacacgcgccacggagctgggtgacccg
accgcgctggacctgttcacccggctggggcgctggctcgggatcgggatcgcgtcgctg
gccaacatcttcgagatcgaggccgtcgtcatcggcggcggcctggtcgcgaccggcgac
ctgctgctcgaccccgcccgcgccgcctaccgcgagcacgcctacgccacggaggcgcgg
cccgtcgtcccggtgcgggtgggcaccttcggcaccgacgccggcgtcgtcggcgcgggg
ctgctcgggctcgagcacgcggaggaccgcagggtccacgccgtcccgccggagcgcgcc
acccgttag

  All links  
No link information was found.   
DBGET integrated database retrieval system