KEGG   Pseudonocardia dioxanivorans: Psed_4402Help
Entry
Psed_4402         CDS       T01479                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00010  Glycolysis / Gluconeogenesis
pdx00052  Galactose metabolism
pdx00500  Starch and sucrose metabolism
pdx00520  Amino sugar and nucleotide sugar metabolism
pdx00521  Streptomycin biosynthesis
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
Module
pdx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pdx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_4402
   00052 Galactose metabolism
    Psed_4402
   00500 Starch and sucrose metabolism
    Psed_4402
   00520 Amino sugar and nucleotide sugar metabolism
    Psed_4402
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psed_4402
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Psed_4402
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psed_4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEA26559
JGI: Psed_4402
UniProt: F4CXI5
Position
4729033..4730061
Genome map
AA seq 342 aa AA seqDB search
MRGVTSGHRAPSGRRAIGLDIGGTNIRGAVVADDGTLLAEVSERTPETSDGTTMTKILLG
ITQQLHAQHPEVVAVGVGAAGIVEWPAGLIRWAPNNSYRDWQVRAELEEATGLPATVDND
ANVAALAEARLGRDRYSEMVFLTVGTGVGGGLVLGGVIYRGPSGRGGELGHIIVAPDGPR
CGCGNRGCLEAVASGTALTRMGREAAAAEPAGVIARLGREEEDGVVTGHTVTRATELGDP
TALDLFTRLGRWLGIGIASLANIFEIEAVVIGGGLVATGDLLLDPARAAYREHAYATEAR
PVVPVRVGTFGTDAGVVGAGLLGLEHAEDRRVHAVPPERATR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgtgacgagtggacaccgcgctccgtccgggcgccgcgcgatcggcctcgac
atcggggggaccaacatccgcggcgccgtcgtcgccgacgacgggaccctgctcgccgag
gtctccgaacgcacccccgagacgtccgacggcacgacgatgacgaagatcctgctcggc
atcacccagcagctgcacgcgcagcacccggaggtcgtcgccgtcggggtgggagcggcc
gggatcgtcgagtggccggccgggctgatccggtgggcgcccaacaactcctaccgcgac
tggcaggtccgggccgagctggaggaggccaccgggctgcccgcgaccgtcgacaacgac
gccaacgtcgccgcgctcgccgaggcccgcctcggccgggaccgctactccgagatggtg
ttcctgaccgtcggcaccggcgtcggaggtgggctcgtcctgggcggggtcatctaccgc
ggaccgtccgggcgcggcggcgagctggggcacatcatcgtcgcacccgacggtccccgc
tgcggctgcggcaaccgcggctgcctggaggccgtcgcgtcgggcacggcgctgacccgg
atgggtcgcgaggccgcggcggccgagccggccggcgtgatcgcccggctcggccgcgag
gaggaggacggcgtcgtcaccgggcacaccgtcacacgcgccacggagctgggtgacccg
accgcgctggacctgttcacccggctggggcgctggctcgggatcgggatcgcgtcgctg
gccaacatcttcgagatcgaggccgtcgtcatcggcggcggcctggtcgcgaccggcgac
ctgctgctcgaccccgcccgcgccgcctaccgcgagcacgcctacgccacggaggcgcgg
cccgtcgtcccggtgcgggtgggcaccttcggcaccgacgccggcgtcgtcggcgcgggg
ctgctcgggctcgagcacgcggaggaccgcagggtccacgccgtcccgccggagcgcgcc
acccgttag

DBGET integrated database retrieval system