KEGG   Pseudonocardia dioxanivorans: Psed_4566Help
Entry
Psed_4566         CDS       T01479                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_4566
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psed_4566
  Amino acid metabolism
   00310 Lysine degradation
    Psed_4566
Enzymes [BR:pdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Psed_4566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4892785..4894629
Genome map
AA seq 614 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDRVEVDEPLLEVSTDKVDTEIPSPAAGVLQRIV
AAEDETVEVGAELAVIGDADEAAGGGSDSGGGAGTAQAEPEPAAEPEPEPAAQAEPAATA
EPEPAAASSGSGSGGSGGGSPVSMPELGESVTEGTVTRWLKQVGDTVEVDEPLVEISTDK
VDTEIPSPLAGTLLEITVGEDETVEVGAQLALIGDGSAAAAAPSAPAEKPQEAPAQETKA
EEPAQQAPAQQAAPAEPEPAATQDAPRQSEPAASSSNGSDNGDAAGGDRIPYVTPLVRKL
AAENDVDLATLQGSGVGGRIRKQDVLAAAEKAAEKAAPAAPAPAPAAPAAPAQPAASGAP
RTPTAVPQRADGAPQPGTTVKMPRLRQVIAQRMRESLAVSAQLTTVQEVDVTRVAKLRAA
AKAEFEAREGVKLTYLPFFAKATIEALRAFPQVNASINEETKEVTYHGAVHLAIAVDTPR
GLLVPVIKNAEELNIAGLARHIADVAARTRANKIGPDELSGGTFTITNIGSAGALFDTPI
INQPQVAILGTGAIVKEPKVVAGADGEDVIAIRSVCYLPLTYDHRLVDGADAGRFVSAVK
ARLEEGAFESDLGL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagcgtcaccgagggcacggtcacc
cgctggctcaagcaggagggcgaccgggtcgaggtcgacgagccactgctggaggtctcg
accgacaaggtcgacaccgagatcccgtcgcccgcggccggcgtcctgcagcgcatcgtc
gccgccgaggacgagaccgtcgaggtcggcgccgagctggctgtgatcggtgacgccgac
gaggcggccggtggcgggtccgactccggcggcggcgcgggcaccgcgcaggccgagccc
gagcccgccgccgagcccgagcccgagccggccgcgcaggccgagcccgccgcgacggcc
gagccggagccggcggccgcgtcgtccgggtcgggctcgggcggctccggcggcgggtcc
cccgtctcgatgccggagctgggcgagagcgtcaccgagggcacggtcacccgctggctc
aagcaggtcggcgacaccgtcgaggtcgacgagccgctcgtggagatctcgaccgacaag
gtcgacaccgagatcccctcgccgctcgcggggaccctgctggagatcaccgtcggcgag
gacgagacggtcgaggtgggtgcgcagctcgccctgatcggcgacggctcggccgccgcc
gccgccccgtccgctcccgccgagaagccgcaggaggcccccgcacaggagacgaaggcg
gaggagcccgcgcagcaggccccggcgcagcaggccgccccggcggagcccgagccggcc
gcgacgcaggacgcgccccggcagagcgaaccggccgcgagcagcagcaacgggagcgac
aacggcgatgcggccggtggcgaccgcatcccctacgtgaccccgctcgtgcgcaagctc
gccgcggagaacgacgtcgacctggcgacgctgcagggcagcggcgtcggcggccgcatc
cgcaagcaggacgtgctggccgccgccgagaaggccgcggagaaggccgccccggcggct
cccgcgccggccccggccgcccccgccgctcccgcacagccggccgcgagcggcgcgccg
cgcaccccgacggcggtcccgcagcgtgccgacggcgcgccccagccgggcaccaccgtc
aagatgccgcggctgcgccaggtcatcgcgcagcggatgcgcgagtcgctcgccgtctcg
gcccagctgacgacggtgcaggaggtcgacgtcacccgcgtcgccaagctgcgcgccgcg
gcgaaggccgagttcgaggcccgcgagggcgtcaagctcacgtacctcccgttcttcgcc
aaggccaccatcgaggcgctgcgggcgttcccgcaggtcaacgcgtcgatcaacgaggag
accaaggaggtgacctaccacggcgccgtgcacctggcgatcgcggtcgacaccccccgc
ggcctgctcgtcccggtgatcaagaacgccgaggagctcaacatcgcgggcctggcccgg
cacatcgccgacgtggccgcccgcacccgggccaacaagatcggtcccgacgagctgtcc
ggcggcacgttcacgatcaccaacatcggcagcgcgggcgccctgttcgacaccccgatc
atcaaccagccgcaggtcgcgatcctgggcaccggggcgatcgtcaaggagcccaaggtc
gtcgcgggcgcggacggcgaggacgtcatcgccatccgctcggtctgctacctgccgctg
acctacgaccaccgcctcgtcgacggtgccgacgccggccgcttcgtcagcgccgtcaag
gcccgcctcgaggagggcgcgttcgagtccgacctgggcctgtag

DBGET integrated database retrieval system