KEGG   Pseudonocardia dioxanivorans: Psed_4566Help
Entry
Psed_4566         CDS       T01479                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psed_4566
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psed_4566
  Amino acid metabolism
   00310 Lysine degradation
    Psed_4566
Enzymes [BR:pdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Psed_4566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4892785..4894629
Genome map
AA seq 614 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDRVEVDEPLLEVSTDKVDTEIPSPAAGVLQRIV
AAEDETVEVGAELAVIGDADEAAGGGSDSGGGAGTAQAEPEPAAEPEPEPAAQAEPAATA
EPEPAAASSGSGSGGSGGGSPVSMPELGESVTEGTVTRWLKQVGDTVEVDEPLVEISTDK
VDTEIPSPLAGTLLEITVGEDETVEVGAQLALIGDGSAAAAAPSAPAEKPQEAPAQETKA
EEPAQQAPAQQAAPAEPEPAATQDAPRQSEPAASSSNGSDNGDAAGGDRIPYVTPLVRKL
AAENDVDLATLQGSGVGGRIRKQDVLAAAEKAAEKAAPAAPAPAPAAPAAPAQPAASGAP
RTPTAVPQRADGAPQPGTTVKMPRLRQVIAQRMRESLAVSAQLTTVQEVDVTRVAKLRAA
AKAEFEAREGVKLTYLPFFAKATIEALRAFPQVNASINEETKEVTYHGAVHLAIAVDTPR
GLLVPVIKNAEELNIAGLARHIADVAARTRANKIGPDELSGGTFTITNIGSAGALFDTPI
INQPQVAILGTGAIVKEPKVVAGADGEDVIAIRSVCYLPLTYDHRLVDGADAGRFVSAVK
ARLEEGAFESDLGL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgagagcgtcaccgagggcacggtcacc
cgctggctcaagcaggagggcgaccgggtcgaggtcgacgagccactgctggaggtctcg
accgacaaggtcgacaccgagatcccgtcgcccgcggccggcgtcctgcagcgcatcgtc
gccgccgaggacgagaccgtcgaggtcggcgccgagctggctgtgatcggtgacgccgac
gaggcggccggtggcgggtccgactccggcggcggcgcgggcaccgcgcaggccgagccc
gagcccgccgccgagcccgagcccgagccggccgcgcaggccgagcccgccgcgacggcc
gagccggagccggcggccgcgtcgtccgggtcgggctcgggcggctccggcggcgggtcc
cccgtctcgatgccggagctgggcgagagcgtcaccgagggcacggtcacccgctggctc
aagcaggtcggcgacaccgtcgaggtcgacgagccgctcgtggagatctcgaccgacaag
gtcgacaccgagatcccctcgccgctcgcggggaccctgctggagatcaccgtcggcgag
gacgagacggtcgaggtgggtgcgcagctcgccctgatcggcgacggctcggccgccgcc
gccgccccgtccgctcccgccgagaagccgcaggaggcccccgcacaggagacgaaggcg
gaggagcccgcgcagcaggccccggcgcagcaggccgccccggcggagcccgagccggcc
gcgacgcaggacgcgccccggcagagcgaaccggccgcgagcagcagcaacgggagcgac
aacggcgatgcggccggtggcgaccgcatcccctacgtgaccccgctcgtgcgcaagctc
gccgcggagaacgacgtcgacctggcgacgctgcagggcagcggcgtcggcggccgcatc
cgcaagcaggacgtgctggccgccgccgagaaggccgcggagaaggccgccccggcggct
cccgcgccggccccggccgcccccgccgctcccgcacagccggccgcgagcggcgcgccg
cgcaccccgacggcggtcccgcagcgtgccgacggcgcgccccagccgggcaccaccgtc
aagatgccgcggctgcgccaggtcatcgcgcagcggatgcgcgagtcgctcgccgtctcg
gcccagctgacgacggtgcaggaggtcgacgtcacccgcgtcgccaagctgcgcgccgcg
gcgaaggccgagttcgaggcccgcgagggcgtcaagctcacgtacctcccgttcttcgcc
aaggccaccatcgaggcgctgcgggcgttcccgcaggtcaacgcgtcgatcaacgaggag
accaaggaggtgacctaccacggcgccgtgcacctggcgatcgcggtcgacaccccccgc
ggcctgctcgtcccggtgatcaagaacgccgaggagctcaacatcgcgggcctggcccgg
cacatcgccgacgtggccgcccgcacccgggccaacaagatcggtcccgacgagctgtcc
ggcggcacgttcacgatcaccaacatcggcagcgcgggcgccctgttcgacaccccgatc
atcaaccagccgcaggtcgcgatcctgggcaccggggcgatcgtcaaggagcccaaggtc
gtcgcgggcgcggacggcgaggacgtcatcgccatccgctcggtctgctacctgccgctg
acctacgaccaccgcctcgtcgacggtgccgacgccggccgcttcgtcagcgccgtcaag
gcccgcctcgaggagggcgcgttcgagtccgacctgggcctgtag

DBGET integrated database retrieval system