KEGG   Pseudonocardia dioxanivorans: Psed_4695Help
Entry
Psed_4695         CDS       T01479                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Psed_4695
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Psed_4695
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Psed_4695
Lipid biosynthesis proteins [BR:pdx01004]
 Desaturase
  First
   Psed_4695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5032229..5033197
Genome map
AA seq 322 aa AA seqDB search
MTVADSPARPAESDGAAGPGPKPILDGTRGLPQQIGVYVFVMVPLLALVAAIPLAVGWGL
LGWSDVVIGLVFYVVSGLGITVGYHRYFTHGSFKANRPLRIGLAVAGSLAMQGPVIDWVA
DHRRHHAFSDKEGDPHSPWLHGSGPLGLAKGFWHSHMGWLFDRDQTNEERFTPDLLADTD
IRRVDALFGLWSVLTLLVPAGLGALVTWSWQGALTALFWAGLVRVGLLHHVTWSINSICH
MWGDRPFAARDRSANVWPLAIASFGESWHNLHHADPTCARHGVKRGQVDISARVIRTFEK
LGWATAVRWPTERRLQRIAREA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccgacagcccggccaggccggccgagagcgacggggccgccggccccggc
ccgaagccgatcctcgacggcacccgcggactgccccagcagatcggcgtgtacgtgttc
gtcatggtcccgctgctggcactcgtcgcggcgatcccgctggccgtcgggtgggggctg
ctcggctggtcggacgtcgtgatcggcctggtgttctacgtcgtcagcgggctgggcatc
accgtcggctaccaccgctacttcacccacggctcgttcaaggccaaccggccgctgcgg
atcgggctggccgtcgcgggcagcctcgcgatgcaggggcccgtcatcgactgggtggcc
gaccaccgccgccaccacgcgttctccgacaaggagggcgatccgcactcgccatggctg
cacggctcgggcccgctcgggctggcgaagggcttctggcactcgcacatgggctggctc
ttcgaccgcgaccagaccaacgaggaacggttcacccccgacctgctggccgacaccgac
atccgccgcgtcgacgcgctgttcgggctctggagcgtgctgacgctgctcgtcccggcg
gggctcggggcgctggtcacatggtcgtggcagggcgcgctgacggccctgttctgggcg
ggcctcgtccgggtggggctgctgcaccacgtcacctggtcgatcaactcgatctgccac
atgtggggcgaccgccccttcgcggcccgcgaccgctccgccaacgtctggcccctggcc
atcgcctccttcggcgagtcctggcacaacctgcaccacgccgacccgacctgcgcccgc
cacggcgtcaaacgcggccaggtcgacatctccgcccgggtgatccggaccttcgagaag
ctcggctgggcgacggcggtgcgctggcccaccgagcgccggctgcagcggatcgcccgg
gaggcctga

DBGET integrated database retrieval system