KEGG   Pseudonocardia dioxanivorans: Psed_4782Help
Entry
Psed_4782         CDS       T01479                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pdx01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pdx00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pdx00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5118634..5120835)
Genome map
AA seq 733 aa AA seqDB search
MAATPTARDTGRTAGAQDAGLQVDPALDRFVTEELLAGLDDITPARFWSALAELQADFAP
RVREVLERRDALQARIDGWHAEHPGPVTGATRDAYARFLTDIGYLEPEAQPRLTVTNVDP
EIAEVAGAQLVVPATVPRYALNAANARWGSLYDALYGTDVLPLDHELAPGYDERRGAQVI
AEADRLLDELFPLADGSHADVDAYTVADGALVPALADPAGFAGHRGDAAEPTAVLLRRNG
LHVELRIDRAHRVGRGHHAGVADVVLESAVTTIVDLEDSVATVDGEDKASAYRTWLGLMT
GNLVASFEKGGQTVTRRAEPDRDHTAPDGSTVTLPGRSVMLVRVVGHHMTTDAVRTAAGD
QVVEGLLDLLVAATAALHDLRGLGPHRNSRTGSVYVVKPKQHGSAEVALTVEMFAAVERA
LGLPERTLKVGVMDEEKRTSVNLEACIAAAQDRVIFVNTGFLDRTGDEIHTCFAGGPVVR
KGDMRSATWFGAYEDRNVDVALRAGFADVAQIGKGMWAKPAAMREMLEAKIEHPRAGADT
AWVPSPTAATLHALHYLRVDVGERQREIAARPLTDRALLLEPPLLGPGSTGRPSADDVRH
ELETNAQSILGYVVRWVGLGIGCSTVPDLEGVGLMEDRATLRISSQLIANWLAHGIVDEQ
TVRETFARLAAFVDEQNAREPGYRPMSDDLEASESFQAALELVFTGREEPNGYTERVLTA
WRRKAKENAGRQA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaacaccgaccgctcgcgacaccggccggacggccggggcgcaggacgcgggc
ctgcaggtcgaccccgcactggacaggttcgtgaccgaggagctgttggccggtctcgac
gacatcaccccggcgcggttctggtccgcgctcgccgagctccaggccgacttcgcgccg
cgcgtgcgtgaggtgctggagcgccgcgacgcgctgcaggcccggatcgacggctggcac
gccgagcacccgggcccggtcaccggcgcgaccagggacgcgtacgcgcgcttcctcacc
gacatcggctacctggaaccggaggcgcagcctcggctcacggtgacgaacgtcgacccg
gagatcgccgaggtggcgggcgcccagctcgtcgtgccggcgacggtgccgcgctacgcg
ctcaacgccgccaacgcccgctggggttcgctgtacgacgcgctctacgggaccgacgtg
ctgccgctggaccacgagctcgcgcccgggtatgacgagcggcgcggcgcccaggtcatc
gccgaggccgaccgcctgctcgacgagctgttcccgctggccgacggctcgcacgccgac
gtcgacgcgtacacggtcgccgacggcgcgctcgtccccgcgctggccgatccggccggg
ttcgccgggcaccgcggcgacgcggccgagccgacagcagtcctgttgcgccgcaacggg
ttacacgtcgagctccggatcgaccgggcacaccgcgtcgggcgcggtcatcacgcgggc
gtcgccgacgtggtgctggagtcggcggtcacgacgatcgtcgacctcgaggactccgtc
gcgaccgtcgacggcgaggacaaggcgagcgcctaccgcacgtggctcggcctgatgacc
gggaacctggtcgccagcttcgagaagggcggccagaccgtcacccggcgcgccgagccc
gaccgcgaccacaccgcgcccgacggttcgacggtcaccctgccgggacggtcggtgatg
ctggtgcgcgtcgtcggccaccacatgacgaccgacgccgtgcgcaccgccgccggggac
caggtcgtcgaggggctgctcgacctgctcgtcgcggccaccgcggcgctgcacgacctg
cgcggcctcgggccgcaccgcaactcccgcaccggcagcgtctacgtcgtgaagccgaag
cagcacggctcggccgaggtggccctgaccgtcgagatgttcgcggcggtcgagcgcgcg
ctggggctgcccgagcggacgctcaaggtcggcgtcatggacgaggagaagcggacgtcg
gtcaacctggaggcgtgcatcgccgccgcccaggaccgggtgatcttcgtcaacaccggc
ttcctcgaccgcaccggcgacgagatccacacctgcttcgcgggcggcccggtggtgcgc
aagggcgacatgcggtcggcgacgtggttcggcgcgtacgaggaccgcaacgtcgacgtc
gcgctgcgggccgggttcgccgacgtcgcccagatcggcaagggcatgtgggccaagccc
gccgcgatgcgcgagatgctcgaggccaagatcgagcacccccgcgcgggcgccgacacc
gcgtgggtgccctcgcccaccgccgcgaccctgcacgcgctgcactacctgcgcgtcgac
gtcggcgagcggcagcgcgagatcgcggcgcgtcccctgaccgaccgcgcgctgctgctg
gagccgccgctgctcggcccggggtcgacggggcggccatcggccgacgacgtccgtcac
gagctggagacgaacgcccagtcgatcctgggttacgtcgtgcgctgggtggggctgggc
atcgggtgctcgacggtgccggacctggagggcgtcgggctcatggaggaccgcgccacg
ctgcggatctccagccagctcatcgccaactggctcgcgcacggcatcgtcgacgagcag
acggtccgggagacgttcgcccggctcgcggccttcgtcgacgagcagaacgcccgcgag
cccggctaccggccgatgagcgacgacctggaggcgagcgagtcgttccaggccgcgctg
gagctggtgttcaccggtcgtgaggaaccgaacggctacaccgagcgggtgctcaccgcg
tggcgccgcaaggccaaggagaacgcgggccggcaggcctga

DBGET integrated database retrieval system