KEGG   Pseudonocardia dioxanivorans: Psed_4782Help
Entry
Psed_4782         CDS       T01479                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00620  Pyruvate metabolism
pdx00630  Glyoxylate and dicarboxylate metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psed_4782
   00630 Glyoxylate and dicarboxylate metabolism
    Psed_4782
Enzymes [BR:pdx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psed_4782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEA26928
JGI: Psed_4782
UniProt: F4D1L6
Position
complement(5118634..5120835)
Genome map
AA seq 733 aa AA seqDB search
MAATPTARDTGRTAGAQDAGLQVDPALDRFVTEELLAGLDDITPARFWSALAELQADFAP
RVREVLERRDALQARIDGWHAEHPGPVTGATRDAYARFLTDIGYLEPEAQPRLTVTNVDP
EIAEVAGAQLVVPATVPRYALNAANARWGSLYDALYGTDVLPLDHELAPGYDERRGAQVI
AEADRLLDELFPLADGSHADVDAYTVADGALVPALADPAGFAGHRGDAAEPTAVLLRRNG
LHVELRIDRAHRVGRGHHAGVADVVLESAVTTIVDLEDSVATVDGEDKASAYRTWLGLMT
GNLVASFEKGGQTVTRRAEPDRDHTAPDGSTVTLPGRSVMLVRVVGHHMTTDAVRTAAGD
QVVEGLLDLLVAATAALHDLRGLGPHRNSRTGSVYVVKPKQHGSAEVALTVEMFAAVERA
LGLPERTLKVGVMDEEKRTSVNLEACIAAAQDRVIFVNTGFLDRTGDEIHTCFAGGPVVR
KGDMRSATWFGAYEDRNVDVALRAGFADVAQIGKGMWAKPAAMREMLEAKIEHPRAGADT
AWVPSPTAATLHALHYLRVDVGERQREIAARPLTDRALLLEPPLLGPGSTGRPSADDVRH
ELETNAQSILGYVVRWVGLGIGCSTVPDLEGVGLMEDRATLRISSQLIANWLAHGIVDEQ
TVRETFARLAAFVDEQNAREPGYRPMSDDLEASESFQAALELVFTGREEPNGYTERVLTA
WRRKAKENAGRQA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaacaccgaccgctcgcgacaccggccggacggccggggcgcaggacgcgggc
ctgcaggtcgaccccgcactggacaggttcgtgaccgaggagctgttggccggtctcgac
gacatcaccccggcgcggttctggtccgcgctcgccgagctccaggccgacttcgcgccg
cgcgtgcgtgaggtgctggagcgccgcgacgcgctgcaggcccggatcgacggctggcac
gccgagcacccgggcccggtcaccggcgcgaccagggacgcgtacgcgcgcttcctcacc
gacatcggctacctggaaccggaggcgcagcctcggctcacggtgacgaacgtcgacccg
gagatcgccgaggtggcgggcgcccagctcgtcgtgccggcgacggtgccgcgctacgcg
ctcaacgccgccaacgcccgctggggttcgctgtacgacgcgctctacgggaccgacgtg
ctgccgctggaccacgagctcgcgcccgggtatgacgagcggcgcggcgcccaggtcatc
gccgaggccgaccgcctgctcgacgagctgttcccgctggccgacggctcgcacgccgac
gtcgacgcgtacacggtcgccgacggcgcgctcgtccccgcgctggccgatccggccggg
ttcgccgggcaccgcggcgacgcggccgagccgacagcagtcctgttgcgccgcaacggg
ttacacgtcgagctccggatcgaccgggcacaccgcgtcgggcgcggtcatcacgcgggc
gtcgccgacgtggtgctggagtcggcggtcacgacgatcgtcgacctcgaggactccgtc
gcgaccgtcgacggcgaggacaaggcgagcgcctaccgcacgtggctcggcctgatgacc
gggaacctggtcgccagcttcgagaagggcggccagaccgtcacccggcgcgccgagccc
gaccgcgaccacaccgcgcccgacggttcgacggtcaccctgccgggacggtcggtgatg
ctggtgcgcgtcgtcggccaccacatgacgaccgacgccgtgcgcaccgccgccggggac
caggtcgtcgaggggctgctcgacctgctcgtcgcggccaccgcggcgctgcacgacctg
cgcggcctcgggccgcaccgcaactcccgcaccggcagcgtctacgtcgtgaagccgaag
cagcacggctcggccgaggtggccctgaccgtcgagatgttcgcggcggtcgagcgcgcg
ctggggctgcccgagcggacgctcaaggtcggcgtcatggacgaggagaagcggacgtcg
gtcaacctggaggcgtgcatcgccgccgcccaggaccgggtgatcttcgtcaacaccggc
ttcctcgaccgcaccggcgacgagatccacacctgcttcgcgggcggcccggtggtgcgc
aagggcgacatgcggtcggcgacgtggttcggcgcgtacgaggaccgcaacgtcgacgtc
gcgctgcgggccgggttcgccgacgtcgcccagatcggcaagggcatgtgggccaagccc
gccgcgatgcgcgagatgctcgaggccaagatcgagcacccccgcgcgggcgccgacacc
gcgtgggtgccctcgcccaccgccgcgaccctgcacgcgctgcactacctgcgcgtcgac
gtcggcgagcggcagcgcgagatcgcggcgcgtcccctgaccgaccgcgcgctgctgctg
gagccgccgctgctcggcccggggtcgacggggcggccatcggccgacgacgtccgtcac
gagctggagacgaacgcccagtcgatcctgggttacgtcgtgcgctgggtggggctgggc
atcgggtgctcgacggtgccggacctggagggcgtcgggctcatggaggaccgcgccacg
ctgcggatctccagccagctcatcgccaactggctcgcgcacggcatcgtcgacgagcag
acggtccgggagacgttcgcccggctcgcggccttcgtcgacgagcagaacgcccgcgag
cccggctaccggccgatgagcgacgacctggaggcgagcgagtcgttccaggccgcgctg
gagctggtgttcaccggtcgtgaggaaccgaacggctacaccgagcgggtgctcaccgcg
tggcgccgcaaggccaaggagaacgcgggccggcaggcctga

DBGET integrated database retrieval system