KEGG   Pseudonocardia dioxanivorans: Psed_4839Help
Entry
Psed_4839         CDS       T01479                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psed_4839
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Psed_4839
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Psed_4839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5195787..5198141)
Genome map
AA seq 784 aa AA seqDB search
MPSTSSDDLTVLDAWWRAANYLSVGQIYLLDNPLLREPLAAEHVKPRLLGHWGTTPGLNL
LYAHMNRVIKARDLNALYVTGPGHGGPGLVANAYLEGTYSEVYSGIGEDADGLRALFRQF
SFPGGVPSHVAPETPGSIHEGGELGYALVHAYGAVFDNPDLLALCVVGDGEAETGPLAAS
WHSNKFLDPRRDGVVLPVLHLNGYKIANPTVLARIPEAELAALMRGYGYAPRFVTAGSDT
DHSAVHEELAARLDAALDEIAAIKADPPVGRPAWPMIVLRTPKGWTGPREVDGKPVEGTF
RAHQVPLAGTRTDERHRAQLEEWMRSYRPEELFDEHGRLVDEIRALAPRGERRMSANPHT
NGGVVLRDLAMPDFRSFAVPVDKPAVEMSEATRVLGEFLREVVRRNPDRFRLFGPDEVAS
NRLQAVFDVTDRAWNAAVEPGDEHLAPGGRVMEILSEHLCQGWLEGYLLTGRHGLFTSYE
AFIHIVDSMLNQHAKWLKTTRAIPWRPPIASLNYLLSSHVWRQDHNGFSHQDPGFLDHVV
NKKAEITRVYLPPDTNTLLSVADHCLRSRHYVNVIVAGKQPQLTYLSTDEAIAHCTRGLG
IWEWASTPVADGADDPDVVLACCGDIPTLETLAAAALLREHLPELRVRVINIVDLMRLQP
DREHPHGLSDREFDALFTVDKPVIFAFHGYPWLIHRLTYSRNGHHNLHVRGYKEEGTTTT
PFDMVMLNDLDRFHLVMDVIDRVPTLGSRAATLRQDMADRRLAARAYTREHGEDDPEIAD
WRWE
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcgacctcgtccgacgacctgaccgtgctcgacgcctggtggcgagcggcgaac
tacctgtccgtggggcagatctacctgctcgacaacccgttgctccgcgaaccgctggcc
gccgagcacgtcaagccgcggttgctcggccactggggaacgacgcccgggctgaacctg
ctctacgcgcacatgaaccgggtgatcaaggctcgggacctgaacgcgctctacgtgacc
gggcccgggcacggcgggccgggcctggtggccaacgcctacctcgaaggcacctacagc
gaggtctactccggcatcggggaggacgccgacgggctgcgtgcgctgttccggcagttc
tccttccccggtggggtgcccagtcatgtcgccccggagacgccggggtcgatccacgag
ggcggcgagctcggctacgcgctggtgcacgcctacggcgccgtgttcgacaacccggac
ctgctggcactgtgcgtcgtgggcgacggcgaggccgagaccggtccgctggcggcgagc
tggcactcgaacaagttcctcgacccgcgccgggacggcgtcgtgctgccggtcctgcac
ctcaacggctacaagatcgcgaacccgacggtgctggcccggatccccgaagcggagctc
gccgcgctgatgcggggctacggatacgcgccccggttcgtcaccgccggcagcgacacg
gaccactcggcggtgcacgaggagctcgccgcgaggctcgacgccgcgctcgacgagatc
gcggcgatcaaggcggacccgccggtcggacgcccggcgtggccgatgatcgtgctgcgc
acgccgaagggctggaccgggccacgggaggtcgacggcaagccggtcgagggcaccttc
cgcgcccaccaggtccccctcgccggaacccggaccgacgagcgacatcgcgcccagctc
gaggagtggatgcgcagctaccggcccgaggagttgttcgacgagcacgggcggctcgtc
gacgagatccgcgccctggcgccccgcggggagcgccggatgagcgcgaacccgcacacc
aacggcggggtggtgctgcgcgacctcgcgatgccggacttccgctccttcgccgtgccc
gtggacaagcccgccgtcgagatgagcgaggccacgcgcgtgctcggtgagtttctgcgg
gaggtggtgcgccgcaaccccgaccggttccggctcttcgggcccgacgaggtcgcgtcg
aaccggctgcaggcggtcttcgacgtgaccgaccgggcctggaacgcggccgtggagccg
ggcgacgagcacctggccccgggcgggcgggtcatggagatcctctccgagcacctctgc
cagggctggctggagggctacctgctcaccggtcggcacgggctgttcaccagctacgag
gcgttcatccacatcgtggactccatgctcaaccagcacgccaagtggctcaagaccacc
cgcgcgatcccgtggcggcccccgatcgcgtcgctgaactacctcctgtccagccatgtc
tggcgtcaggaccacaacggtttctcccaccaggacccgggcttcctcgaccacgtggtg
aacaagaaggcggagatcacccgcgtctacctgcccccggacaccaacaccctgctctcc
gtcgcggaccactgcctgcgcagtcgccactacgtcaacgtgatcgtggccggcaagcag
ccgcagctgacgtacctgtcgacggacgaggccatcgcgcactgcacccgcgggctcggc
atctgggaatgggcgtccacaccggtggcggacggtgccgacgacccggatgtcgtgctg
gcctgctgcggcgacatccccacgctggagacgctcgccgcggccgcgctgctgcgcgag
catctacccgagctgagggtgcgggtgatcaacatcgtggacctgatgcggctgcagccc
gaccgcgagcacccgcacggtctgtccgaccgggagttcgacgcgctgttcaccgtggac
aaaccggtgatcttcgccttccacggctacccgtggctgatccaccgcctgacgtactcc
cgcaacggccaccacaacctccacgtgcgcggctacaaggaggagggcaccaccacgacg
ccgttcgacatggtcatgctcaacgacctcgatcgcttccacctggtgatggatgtgatc
gaccgggtgccgacgctcggcagccgggccgccactcttcgccaggacatggccgaccgt
cggctcgccgcccgcgcgtacacccgcgagcacggcgaggacgacccggagatcgccgac
tggcggtgggaatga

DBGET integrated database retrieval system