KEGG   Pseudonocardia dioxanivorans: Psed_4985Help
Entry
Psed_4985         CDS       T01479                                 

Definition
zinc-binding alcohol dehydrogenase protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pdx01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdx00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pdx00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pdx00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pdx00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pdx00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5339765..5340760)
Genome map
AA seq 331 aa AA seqDB search
MDAWIVDRPGPGSPLVRAELPDPQPGPGEVRIRVRACGVCRTDLHLAEGDLPPRRPGTVP
GHEIVGTVDALGPGAGRFGIGDRIGVAWLRGTCGRCRFCRTGRENLCPDAAFTGWDADGG
YAERAVVPEAYAYALPAALDDVTAAPLLCAGIVGYRALVRAELPPGGRLGIYGFGASAHV
VAQVAIAQGATVHVLTRSPAARELALSLGAASAGPAADGPPEPLDSAVTFAPDGGVVPLA
LRALDAGGTLAVAGIHLSDVPALDYERELFRERQLRSVTANTRADGEEFLRLAGALRVRP
TVDPRPMSTADRALADLAAGRVTGAAVLVGE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcgtggatcgtcgaccgccccggaccgggatcaccgctggtccgggcggagctc
ccggacccgcagcccgggcccggcgaggtgcggatccgggtgcgcgcgtgcggggtgtgc
cgcaccgacctgcacctggccgagggtgacctgccgccgcggcgtcccgggacggtgccg
gggcacgagatcgtcggcacggtcgacgcgctcggcccgggtgccggccggttcgggatc
ggcgaccggatcggcgtggcgtggctgcgcggcacgtgcgggcggtgccggttctgccgc
accggccgggagaacctctgtcccgacgccgcattcaccggctgggacgccgacggcggg
tacgccgagcgcgccgtcgtgcccgaggcctacgcctacgcgctgcccgccgcgctcgac
gacgtcaccgcggcgccgctgctgtgcgccgggatcgtcggctatcgggcgctggtccgg
gccgagctgccgccgggcgggcggctcgggatctacggcttcggggcctcggcgcacgtc
gtcgcgcaggtcgcgatcgcccagggcgccacggtccacgtgctgacccgctccccggcg
gcccgcgagctcgccctgtcgctgggcgcggcgtcggccggtccggccgccgacggcccg
cccgaaccgctcgactcggccgtgacgttcgcgcccgacgggggcgtcgtgccgctcgcg
ctgcgcgcactcgacgcgggcggcacgctggccgtcgccggcatccacctctccgacgtc
ccggcgctcgactacgagcgcgagctgttccgcgagcgacagctgcgcagcgtcaccgcc
aacacccgggccgacggcgaggagttcctgcggctcgccggcgcgctgcgggtgcggccg
accgtcgacccgcgtccgatgtcgaccgccgaccgggcgctcgccgatctggccgccggc
cgggtcaccggcgcggcggtgctggtgggcgaatga

DBGET integrated database retrieval system