KEGG   Pseudonocardia dioxanivorans: Psed_5076Help
Entry
Psed_5076         CDS       T01479                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pdx00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5433516..5435033
Genome map
AA seq 505 aa AA seqDB search
MADYVGAIDQGTTSTRFMIFDHSGNEVGRHQLEHEQILPQAGWVEHNPVEIWERTSAVLQ
STLNKTGLSAGDLCALGITNQRETAVVWDRNTGRPYYNAIVWQDTRTDRIASALEREGKG
DTIRQKAGLPPATYFSGGKIQWILENVDGVRAAAERGDAIFGNTDTWLIWNLTGGRDGGV
HCTDVTNASRTMLMNLETLDWDDELLGFFGIPRQMLPEIKPSSYTSGYGNTRGTGPLAGE
VLITGDLGDQQAATVGQVCFAPGEAKNTYGTGNFMLLNTGTELIRSKAGLLSTVCYKFND
EDVVYALEGSIAVTGSAVQWLRDQLGIISGASQSEALARQVEDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRYNTNAHLARATLEAICYQSRDVIEAMEKDSGVHLEVLKVDGGVTMN
ELCMQIQSDVLGVDVSRPVVAETTALGAAYAAGLAVGFWKNTDELRQNWNEARHWSPQWS
DDQRAEGYAKWKKAVERTLNWVDVD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctgactacgtcggcgcgatcgaccagggcacgaccagcacgcggttcatgatcttc
gaccactccggcaacgaggtgggccgccaccagctggagcacgagcagatcctcccccag
gcgggctgggtggagcacaaccccgtcgagatctgggaacgcacctcggcggtgctgcag
agcacgctgaacaagaccgggctgtccgcgggcgacctctgcgcgctgggcatcaccaac
cagcgcgagacggccgtcgtgtgggaccgcaacaccggccgtccctactacaacgcgatc
gtctggcaggacacgcgcaccgaccggatcgcctccgcgctcgagcgcgagggcaagggc
gacaccatccggcagaaggcgggcctgccgcccgcgacgtacttctccggcggcaagatc
cagtggatcctcgagaacgtcgacggggtccgggccgccgccgagcgcggcgacgcgatc
ttcggcaacaccgacacgtggctgatctggaacctcaccggcggtcgcgacggcggcgtg
cactgcaccgacgtcaccaacgccagccgcacgatgctgatgaacctcgagacgctcgac
tgggacgacgagctgctcggcttcttcggcatcccgcggcagatgctgccggagatcaaa
ccgagctcgtacacgtccggctacgggaacacccgggggaccggcccgctggccggcgag
gtgctcatcaccggcgacctcggcgaccagcaggccgcgaccgtcggccaggtgtgcttc
gcacccggcgaggcgaagaacacctacggcaccggcaacttcatgctgctcaacaccggc
acggagctgatccggtcgaaggcgggcctgctctcgacggtctgctacaagttcaacgac
gaggacgtcgtctacgcgctggagggctccatcgcggtgaccggctcggccgtccagtgg
ctgcgcgaccagctcgggatcatctcgggtgcgtcgcagtccgaggcgctggcccgccag
gtcgaggacaacggaggcgtctacttcgtcccggccttctcggggctgttcgcgccctac
tggcgttccgacgcgcgcggcgcgatcgtcgggctgtcgcgctacaacaccaacgcgcac
ctcgcccgggcgacgctcgaggcgatctgctaccagagccgcgacgtgatcgaggccatg
gagaaggactccggcgtacacctcgaggtgctcaaggtcgacggcggcgtcaccatgaac
gagctgtgcatgcagatccagtccgacgtgctgggtgtcgacgtcagcaggcccgtcgtc
gcggagacgacggcgctgggcgcggcctacgcggcgggcctggccgtcgggttctggaag
aacaccgacgagctgcggcagaactggaacgaggcccggcactggtcgccgcagtggagc
gatgaccagcgtgccgaggggtacgcgaagtggaagaaggccgtcgagcggacgttgaac
tgggtggacgtcgactga

DBGET integrated database retrieval system