KEGG   Pseudonocardia dioxanivorans: Psed_5078Help
Entry
Psed_5078         CDS       T01479                                 

Definition
kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Psed_5078
Enzymes [BR:pdx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Psed_5078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5436833..5438050)
Genome map
AA seq 405 aa AA seqDB search
MTPTLADAERLDAADPLASFRDRFLVPDDPGLVAYLDGNSLGRPPKATAERLAALVTHDW
GTRLIRSWSEGWMELPFEIGDRLAAAVLGAEPGQTVVADSTTVCLYKLMRAAAAMRPGRD
EVVADRGNFPTDRYVVEAVAAECGLTVRWISPDPAGGVTLADVVDHVGERTAFVTLSHVA
YRSAWIADLHGITAAAHDAGALVVWDLCHSVGSVPLDLDAAGVDLAAGCTYKFLNAGPGA
PAFLYVAAALQDGFAQPITGWMGHAEPFAMGRDYAPATGMRRALSGTPPITGLIGVDEGV
KLVAEAGMDRIRAKAVALTELAVTLADDLLDGVGIGSPRDPARRGGHVTVTHPDAKTLSD
RLIAAGVVVDHRPPDGIRIGLSPLTTSFAELHRAMTVFADVLQMS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccccacgctcgccgacgccgagaggctcgacgccgccgatccgctcgcctccttc
cgtgaccgcttcctcgtccccgacgacccgggtctcgtcgcctacctcgacggcaactcg
ctcggccgtcctccgaaggcgacggccgagcggctcgccgcgctcgtcacgcacgactgg
gggacccgcctcatccggtcctggtcggagggctggatggagctgccgttcgagatcggc
gaccggctcgcggccgcggtgctcggcgcggaaccggggcagacggtcgtcgccgactcg
acgacggtgtgcctctacaagctgatgcgcgccgccgcggcgatgcggcccggccgcgac
gaggtcgtcgccgaccgcggcaacttcccgaccgaccgctacgtcgtcgaggccgtcgcc
gcggagtgcgggctgacggtgcgctggatctcgcccgacccggcgggcggggtcaccctc
gccgatgtcgtcgaccacgtcggcgagcggaccgcgttcgtcacgctctcccacgtcgcg
tacaggtccgcctggatcgccgacctgcacggcatcaccgccgcggcccacgacgccggc
gcactcgtggtctgggacctgtgccacagcgtcggctcggtgccgctcgacctcgacgcc
gcgggtgtcgacctcgccgccggctgcacctacaagttcctcaacgcgggtcccggcgca
cccgcgttcctctacgtcgccgccgcgctgcaggacgggttcgcccagccgatcaccggc
tggatgggccacgccgagccgttcgcgatgggtcgggactacgcgccggcgacggggatg
cgccgcgcgctgtcggggacgccgccgatcaccggcctgatcggtgtcgacgagggcgtg
aagctcgtcgccgaggcggggatggaccgcatccgcgcgaaggcggtcgcgctcacggag
ctggcggtgaccctggccgacgacctcctggacggcgtcggcatcggctccccgcgcgat
cccgcccgccgcggcggccacgtcacggtcacgcacccggacgcgaagacgctgtccgac
aggctgatcgcggccggtgtcgtcgtcgaccaccggccgcccgacggcatccggatcggc
ctgtcgccgctcacgacgtcgttcgccgagctgcatcgcgcgatgaccgtgttcgcggac
gtcctgcagatgtcgtga

DBGET integrated database retrieval system