KEGG   Pseudonocardia dioxanivorans: Psed_5332Help
Entry
Psed_5332         CDS       T01479                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00020  Citrate cycle (TCA cycle)
pdx00640  Propanoate metabolism
pdx00660  C5-Branched dibasic acid metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
Module
pdx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psed_5332
   00640 Propanoate metabolism
    Psed_5332
   00660 C5-Branched dibasic acid metabolism
    Psed_5332
Enzymes [BR:pdx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Psed_5332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATPgrasp_Ter ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEA27466
JGI: Psed_5332
UniProt: F4CUZ7
Position
complement(5697767..5698939)
Genome map
AA seq 390 aa AA seqDB search
MDLYEYQAKELFAAHGVPVLPGRTVETADDAAAAAAELGTAVVVKAQVKTGGRGKAGGVK
LAENADEAKEKAGAILGMDIKGHTVHRVLVTTASDIAEEYYFSFLLDRSNRTFLAMCSAE
GGMEIEQLAVERPDALARIPVDAIAGVDKAKADEIVAAGKIPAAVAEEAAQVIVKLWETF
VSEDATLVEVNPLVRDPQDKVIALDGKVTLDENADFRHPDHAGLVDERTENALEAKAKAK
GLNYVKLDDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAQVMADGL
DVILGDPDVKSVFVNVFGGITACDAVATGIVEALKILGDAATKPLVVRLDGNNVIEGRRI
LDEANHPLVTQVDTMDNAADKAAQLAAAGA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggcgaaggaactcttcgccgcacacggagtcccggtgctg
ccgggccggaccgtcgagaccgcggacgacgcggccgcggccgccgccgagctgggcacc
gcggtcgtcgtgaaggcgcaggtgaagacgggcggccgtggcaaggcgggcggtgtcaag
ctcgccgagaacgcggacgaggccaaggagaaggccggggccatcctcggcatggacatc
aagggccacaccgtccaccgcgtcctggtgacgaccgccagtgacatcgccgaggagtac
tacttctcgttcctgctcgaccgctccaaccgcaccttcctggccatgtgctcggccgag
ggcggcatggagatcgagcagctggccgtcgagcgccccgacgcgctcgcgcgcatcccc
gtcgacgccatcgccggcgtcgacaaggcgaaggccgacgagatcgtcgccgccgggaag
atccccgccgcggtcgccgaggaggccgcgcaggtcatcgtcaagctgtgggagaccttc
gtctccgaggacgcgacgctggtcgaggtcaacccgctcgtgcgcgacccgcaggacaag
gtcatcgcgctcgacggcaaggtcaccctggacgagaacgccgacttccgccaccccgac
cacgccggtctggtcgacgagcgcaccgagaacgcgctcgaggccaaggcgaaggccaag
ggcctcaactacgtcaagctcgacgacggccaggtcgggatcatcggcaacggcgcgggc
ctggtcatgtcgaccctcgacgtcgtcgcgtacgccggcgagaagcacggcggggtcaag
ccggccaacttcctcgacatcggcggcggcgcgtcggcccaggtcatggccgacggcctc
gacgtcatcctcggcgaccccgacgtcaagagcgtgttcgtcaacgtcttcggcggcatc
accgcgtgcgacgcggtcgccaccggcatcgtcgaggccctgaagatcctgggcgacgcg
gccaccaagccgctggtcgtgcggctcgacggcaacaacgtcatcgaggggcgccggatc
ctcgacgaggccaaccacccgctggtcacgcaggtggacacgatggacaacgcggccgac
aaggccgcccagctcgcggctgcgggggcctga

DBGET integrated database retrieval system