KEGG   Pseudonocardia dioxanivorans: Psed_5617Help
Entry
Psed_5617         CDS       T01479                                 

Definition
(GenBank) Uroporphyrinogen-III C-methyltransferase., Uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00860  Porphyrin and chlorophyll metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
Module
pdx_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psed_5617
Enzymes [BR:pdx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Psed_5617
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Psed_5617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEA27745
JGI: Psed_5617
UniProt: F4CZR9
Position
complement(5986394..5987935)
Genome map
AA seq 513 aa AA seqDB search
MNKATPTPGRIAFVGSGPGDPGLLTVRARAALAAAPLVVMDPDVAEEITALVAEGAELRP
AVGQPADVAAELVAEATAGRAVTRLVSGDPLTTDAVIAEAQAVAKAGVPFDVVPGVPAGT
AVPAYAGVPLGSGHVEADVRAGVDWARIASVPGTLVLHATAAHLGEVAVALTDQGVAAET
PVAITAGGTRNTQKTVDSTLAGLAADGADLEGPLVLSVGRDVAQRAELSWWESRALYGWR
VLVPRTKDQAGAMSDRLRVHGAIPEEVPTIAVEPPRSPTQMERAVKGLVDGRYQWVVFTS
TNAVRAVWEKFAEFGLDARAFSGVKIACVGAATAEKVRAFGIVPEIVPDIDEAQQSTSEG
LLEIFPPYDDILDPVDRVLLPRADIATETLAAGLRDRGWEIDDVTAYRTVRAAPPPAPIR
EAIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPATAETAREFGLRVDVQPEEA
RVPTLVDALAAHAAKLRAEGALPPPKKAKARRR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcaacaccaacgcccggccggatcgccttcgtgggcagtggcccgggcgac
cccgggctgctcaccgtgcgcgcgcgtgccgcgctcgccgcggcgccgctggtcgtcatg
gaccccgacgtggcggaggagatcaccgcgctcgtggccgagggcgccgagctgcgcccc
gccgtcgggcagcctgccgacgtcgcggccgagctggtcgccgaggccaccgcgggccgc
gcggtcacgcgcctggtgagcggcgacccgctgaccaccgacgccgtcatcgcggaggcg
caggccgtcgccaaggcgggcgtgccgttcgacgtcgtccccggggtgcccgcgggcacc
gcggtccccgcgtacgccggcgtaccgctcggctcgggccacgtcgaggccgacgtccgc
gcgggcgtcgactgggcgcgcatcgcgtcggtgcccggcaccctcgtgctgcacgcgacc
gccgcgcacctgggcgaggtcgccgtcgcgctgaccgaccagggcgtcgccgccgagacc
ccggtcgcgatcacggcgggcggcacccgcaacacgcagaagaccgtcgactcgaccctc
gccgggctggccgccgacggcgccgacctcgagggcccgctcgtgctctcggtcgggcgc
gacgtcgcccagcgcgccgagctgtcctggtgggagtcgcgcgcgctctacggctggcgc
gtgctcgtcccgcgcaccaaggaccaggcgggcgcgatgagcgaccggctgcgcgtgcac
ggcgcgatcccggaggaggtgcccaccatcgcggtggagccgccccggtcgcccacgcag
atggaacgcgcggtcaagggcctggtcgacggccgctaccagtgggtcgtcttcacctcg
accaacgcggtgcgtgcggtctgggagaagttcgccgagttcggcctcgacgcccgcgcg
ttctccggcgtgaagatcgcctgcgtcggcgccgcgacggcggagaaggtgcgcgccttc
ggcatcgtcccggagatcgtgccggacatcgacgaggcgcagcagtccacctccgagggc
ctgctggagatcttcccgccctacgacgacatcctcgacccggtcgaccgggtgctgctc
ccgcgggccgacatcgccaccgagaccctcgccgccggtctgcgcgaccgcggctgggag
atcgacgacgtgaccgcctaccggaccgtccgggccgccccgccgcccgcgccgatccgc
gaggccatcaagaccggcggcttcgacgcggtgtgcttcacctcgtcgtcgaccgtccgc
aacctggtgggcatcgcgggcaagccgcacgcccgcacgatcgtcgcctgcatcggcccg
gccaccgccgagaccgcgcgcgagttcgggctgcgtgtcgacgtgcagcccgaggaggcc
cgggtgccgacgctcgtcgacgccctggccgcgcacgccgccaagctgcgcgccgagggc
gccctgccgccgccgaagaaggccaaggcgcgcaggcgctga

DBGET integrated database retrieval system