KEGG   Pseudonocardia dioxanivorans: Psed_5866Help
Entry
Psed_5866         CDS       T01479                                 

Definition
L-iditol 2-dehydrogenase (EC:1.1.1.14)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pdx01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pdx00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pdx00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pdx00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:pdx00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:pdx00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6222753..6223847
Genome map
AA seq 364 aa AA seqDB search
MAATVEAMVLTEAREFAAREFPRPRPGPDDGLLRVELAGICHTDVDIVTGGYPTPLPLIM
GHEIVGRIEEVGERAARRWGVTAGDRVVVEPMVGCGGCRYCTEGNGRFCESAIGYGTATA
CDAEPFLWGAYSPLMYLAPGSLVHRVPDGTSAEVGMLCTVAISNAVQWTLARGGVVQGDD
VVVQGVGPIGLCCVAAARAAGARTVVATGLPHDVLGRALAPEFGADVVVTAGEQDVVAAV
RDATRGELARVVVDTTGSPAALRTSLDLVRRTGTVVSGGVTGKDVLTPLPMDVVTLKEIR
LQGVFSFDSAAVRRAMALAATGLFPFERLVTHRFDLHDAAEAVATVADHALTDRLKVVLV
PPAG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccgtcgaggcgatggtgctcaccgaggcgcgggagttcgccgcgcgcgag
ttcccgcggccgcggccagggcccgacgacgggctgctgcgcgtcgagctggccggcatc
tgccacaccgacgtcgacatcgtcaccggcggctacccgacgccgctgccgctgatcatg
ggtcacgagatcgtcgggcggatcgaggaggtcggcgagcgtgccgcccggcgctggggc
gtcaccgccggggaccgggtggtcgtcgagccgatggtgggctgtggtggctgccgctac
tgcaccgagggcaacggccggttctgcgagtcggcgatcggctacgggacggccaccgcc
tgcgacgccgagcccttcctctggggtgcctactccccgctgatgtacctcgcgcccggc
tcgctcgtgcaccgcgtccccgacggcacgagcgccgaggtcgggatgctctgcaccgtc
gcgatctccaacgccgtgcagtggacgttggcccgcgggggcgtcgtgcagggcgacgac
gtcgtggtgcagggcgtcgggccgatcgggctgtgctgtgtcgcggcggcccgcgcggcg
ggcgcgcgcaccgtggtggcgaccggcctgccgcacgacgtgctcggccgggccctcgcg
cccgagttcggcgccgacgtggtcgtcacggccggggagcaggacgtcgtcgcggcggtg
cgggacgccacgcggggcgagctcgcgcgcgtcgtcgtcgacacgaccggcagccccgcg
gcgctgcggacctcgctggacctggtgcgccgcaccggaaccgtggtcagtggcggcgtc
accggcaaggacgtgctcacaccgctgccgatggacgtcgtcacgctcaaggagatccga
ctgcagggtgtgttcagcttcgacagcgccgccgtgcggcgggcgatggcgttggccgcg
accggtctgttccccttcgaacggctcgtcacccaccggttcgacctgcacgacgcggcc
gaggccgtcgccaccgtcgccgatcacgcgctgaccgaccggctcaaggtcgtcctggtg
cctccggcggggtga

DBGET integrated database retrieval system