KEGG   Pseudonocardia dioxanivorans: Psed_5866Help
Entry
Psed_5866         CDS       T01479                                 

Definition
L-iditol 2-dehydrogenase (EC:1.1.1.14)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Psed_5866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_5866
  Lipid metabolism
   00071 Fatty acid degradation
    Psed_5866
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psed_5866
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psed_5866
   00626 Naphthalene degradation
    Psed_5866
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psed_5866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6222753..6223847
Genome map
AA seq 364 aa AA seqDB search
MAATVEAMVLTEAREFAAREFPRPRPGPDDGLLRVELAGICHTDVDIVTGGYPTPLPLIM
GHEIVGRIEEVGERAARRWGVTAGDRVVVEPMVGCGGCRYCTEGNGRFCESAIGYGTATA
CDAEPFLWGAYSPLMYLAPGSLVHRVPDGTSAEVGMLCTVAISNAVQWTLARGGVVQGDD
VVVQGVGPIGLCCVAAARAAGARTVVATGLPHDVLGRALAPEFGADVVVTAGEQDVVAAV
RDATRGELARVVVDTTGSPAALRTSLDLVRRTGTVVSGGVTGKDVLTPLPMDVVTLKEIR
LQGVFSFDSAAVRRAMALAATGLFPFERLVTHRFDLHDAAEAVATVADHALTDRLKVVLV
PPAG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccgtcgaggcgatggtgctcaccgaggcgcgggagttcgccgcgcgcgag
ttcccgcggccgcggccagggcccgacgacgggctgctgcgcgtcgagctggccggcatc
tgccacaccgacgtcgacatcgtcaccggcggctacccgacgccgctgccgctgatcatg
ggtcacgagatcgtcgggcggatcgaggaggtcggcgagcgtgccgcccggcgctggggc
gtcaccgccggggaccgggtggtcgtcgagccgatggtgggctgtggtggctgccgctac
tgcaccgagggcaacggccggttctgcgagtcggcgatcggctacgggacggccaccgcc
tgcgacgccgagcccttcctctggggtgcctactccccgctgatgtacctcgcgcccggc
tcgctcgtgcaccgcgtccccgacggcacgagcgccgaggtcgggatgctctgcaccgtc
gcgatctccaacgccgtgcagtggacgttggcccgcgggggcgtcgtgcagggcgacgac
gtcgtggtgcagggcgtcgggccgatcgggctgtgctgtgtcgcggcggcccgcgcggcg
ggcgcgcgcaccgtggtggcgaccggcctgccgcacgacgtgctcggccgggccctcgcg
cccgagttcggcgccgacgtggtcgtcacggccggggagcaggacgtcgtcgcggcggtg
cgggacgccacgcggggcgagctcgcgcgcgtcgtcgtcgacacgaccggcagccccgcg
gcgctgcggacctcgctggacctggtgcgccgcaccggaaccgtggtcagtggcggcgtc
accggcaaggacgtgctcacaccgctgccgatggacgtcgtcacgctcaaggagatccga
ctgcagggtgtgttcagcttcgacagcgccgccgtgcggcgggcgatggcgttggccgcg
accggtctgttccccttcgaacggctcgtcacccaccggttcgacctgcacgacgcggcc
gaggccgtcgccaccgtcgccgatcacgcgctgaccgaccggctcaaggtcgtcctggtg
cctccggcggggtga

DBGET integrated database retrieval system