KEGG   Pseudonocardia dioxanivorans: Psed_5866Help
Entry
Psed_5866         CDS       T01479                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00010  Glycolysis / Gluconeogenesis
pdx00071  Fatty acid degradation
pdx00350  Tyrosine metabolism
pdx00625  Chloroalkane and chloroalkene degradation
pdx00626  Naphthalene degradation
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psed_5866
  Lipid metabolism
   00071 Fatty acid degradation
    Psed_5866
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psed_5866
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psed_5866
   00626 Naphthalene degradation
    Psed_5866
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psed_5866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C HAD AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AEA27990
JGI: Psed_5866
UniProt: F4D1T0
Position
6222753..6223847
Genome map
AA seq 364 aa AA seqDB search
MAATVEAMVLTEAREFAAREFPRPRPGPDDGLLRVELAGICHTDVDIVTGGYPTPLPLIM
GHEIVGRIEEVGERAARRWGVTAGDRVVVEPMVGCGGCRYCTEGNGRFCESAIGYGTATA
CDAEPFLWGAYSPLMYLAPGSLVHRVPDGTSAEVGMLCTVAISNAVQWTLARGGVVQGDD
VVVQGVGPIGLCCVAAARAAGARTVVATGLPHDVLGRALAPEFGADVVVTAGEQDVVAAV
RDATRGELARVVVDTTGSPAALRTSLDLVRRTGTVVSGGVTGKDVLTPLPMDVVTLKEIR
LQGVFSFDSAAVRRAMALAATGLFPFERLVTHRFDLHDAAEAVATVADHALTDRLKVVLV
PPAG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccgtcgaggcgatggtgctcaccgaggcgcgggagttcgccgcgcgcgag
ttcccgcggccgcggccagggcccgacgacgggctgctgcgcgtcgagctggccggcatc
tgccacaccgacgtcgacatcgtcaccggcggctacccgacgccgctgccgctgatcatg
ggtcacgagatcgtcgggcggatcgaggaggtcggcgagcgtgccgcccggcgctggggc
gtcaccgccggggaccgggtggtcgtcgagccgatggtgggctgtggtggctgccgctac
tgcaccgagggcaacggccggttctgcgagtcggcgatcggctacgggacggccaccgcc
tgcgacgccgagcccttcctctggggtgcctactccccgctgatgtacctcgcgcccggc
tcgctcgtgcaccgcgtccccgacggcacgagcgccgaggtcgggatgctctgcaccgtc
gcgatctccaacgccgtgcagtggacgttggcccgcgggggcgtcgtgcagggcgacgac
gtcgtggtgcagggcgtcgggccgatcgggctgtgctgtgtcgcggcggcccgcgcggcg
ggcgcgcgcaccgtggtggcgaccggcctgccgcacgacgtgctcggccgggccctcgcg
cccgagttcggcgccgacgtggtcgtcacggccggggagcaggacgtcgtcgcggcggtg
cgggacgccacgcggggcgagctcgcgcgcgtcgtcgtcgacacgaccggcagccccgcg
gcgctgcggacctcgctggacctggtgcgccgcaccggaaccgtggtcagtggcggcgtc
accggcaaggacgtgctcacaccgctgccgatggacgtcgtcacgctcaaggagatccga
ctgcagggtgtgttcagcttcgacagcgccgccgtgcggcgggcgatggcgttggccgcg
accggtctgttccccttcgaacggctcgtcacccaccggttcgacctgcacgacgcggcc
gaggccgtcgccaccgtcgccgatcacgcgctgaccgaccggctcaaggtcgtcctggtg
cctccggcggggtga

DBGET integrated database retrieval system