KEGG   Pseudonocardia dioxanivorans: Psed_5892Help
Entry
Psed_5892         CDS       T01479                                 

Definition
NADPH--hemoprotein reductase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Psed_5892
  Amino acid metabolism
   00380 Tryptophan metabolism
    Psed_5892
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Psed_5892
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Psed_5892
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Psed_5892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6244613..6247855
Genome map
AA seq 1080 aa AA seqDB search
MTTTEIREASEIPGPPPKPVIGNALDIPGDRTIQALMDLTRTYGPIMRLKTPVGDRYIVS
GLEMVDDLCDDSRFDKLVGTAQKELRKTRPSDGLFTADTDDPMWSRAHNILLPNFSMQAM
QGYLPMMIDIALQLMQKWERLNPGEQVDVTADMTRLTLDTIALCGFGYRFNSFYRNTQHP
FVDAMMRTLTETQKRARLLPPLIRLRRKAQRQLMADNKYMEREVQNILDERRRAGNADEH
QDLLSCMLTGVDKKTGLKLPDENIVGQCLTFLVAGHETTSGLLSFTIAYLIKHPDVVAKA
QAEVDRVLGTDPGVMPSFQQVQGLTYVTQILNEILRLWPTAPGFTRYPYEDVVLGGYRIA
KGSSLTALTPMLHRLPEVWGPDAEEFNPDHFRAEFRATLPPNAFKPFGSGQRACIGRQFA
MQEAVLVLGMLLQRFDFVDHLGYELKIKEALTLKPEGLFIQLRPRPDRTTGTVVVAPNAA
QAPAAKPKLRLAPVGDRHGTPLTVLFGSNLGTAEGIATRIAQDGADRGFAVTLGALDDHV
ADLPKEGGLVVVCASYNGMPPDNAERFCAWIRDAATPADTAAGAAYAVFGCGNMDWASTY
QAIPTMLDEQLERHGGRRVVPRGEGDARSDFDGQYEAWYATLWPAMTEALGLETAAVGTA
AAGPRLTVTMTNRQTTNPVVVSYRARPSTVRVNRELNLDGADRSTRHVEIALAPGTEYQT
GDHLGVLPRNNVDLIRRVIARFKLDAGTYVTITPTGGSWTHLPLDEPAPLLGVLGSCVEL
QDVAGRSDIATLAASATDPAEREALQALTTLDDEGRARYRKTIAEPRVTVLDLLDAYPSC
DLSFAQFLDMLPPLRPRYYSISSAPSESETCHITVGVLDVPARGRDGRFAGVCSTHLRSC
ETDSTVFTFVRRPTIPFRPPENPHTPMIMVGAGTGMAPFRGFLQERAGLRRRGVPVGESL
LFFGCRTPEQDFLYSDELRAFERDGIVRLCMAFSRVADNRRYVQQAILDEQEDVRRLLDQ
GAHVYVCGNANTMAPAVRAALIEVHQGGDGTADTDGDAWLAGLRAAQRYLEDIWGESAVG
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaccgagatccgcgaggcgagcgagatccccggtccgccgccgaagcccgtc
atcggcaacgcgctcgacatcccgggcgaccgcacgatccaggcgttgatggatctgacc
cgtacctacggcccgatcatgcggctcaagaccccggtaggggaccggtacatcgtgtcg
ggcctggagatggtcgacgacctctgcgacgactcccggttcgacaagctcgtcggcacc
gcccagaaggagctgcgcaagacccggccgagcgacggcctgttcaccgcggacaccgac
gacccgatgtggtcgcgcgcgcacaacatcctgctgcccaacttcagcatgcaggccatg
cagggctacctgccgatgatgatcgacatcgcgctgcagctgatgcagaagtgggagcgg
ctcaacccgggcgagcaggtcgacgtcaccgccgacatgacgcgcctgacgctggacacc
atcgcgttgtgcggcttcgggtaccgcttcaactcgttctaccgcaacacccagcacccg
ttcgtcgacgcgatgatgcggacgctgacggagacccagaagcgggcccggctgctcccg
ccgctgatccggctccgccgcaaggcgcagcggcagctcatggcggacaacaagtacatg
gagcgggaggtccagaacatcctcgacgagcggcgccgcgccgggaacgccgacgagcac
caggacctgctgagctgcatgctcacgggcgtcgacaagaagaccgggctgaagctgccc
gacgagaacatcgtcggccagtgtctgacgttcctggtcgcgggccacgagacgacgagc
gggctgctgtcgttcaccatcgcctacctgatcaagcaccccgacgtcgtcgcgaaggcc
caggcggaggtcgaccgcgtgctgggcaccgacccgggcgtcatgccgagcttccagcag
gtccaggggctcacctacgtcacccagatcctcaacgagatcctgcggctctggccgacc
gcgccgggattcacccgctacccctacgaggacgtggtcctcggcgggtaccgcatcgcc
aagggctcatcgttgacggcgctgaccccgatgctgcaccgcctaccggaggtctggggg
ccggacgccgaggagttcaaccccgaccacttccgggccgagttccgcgcgacgttgccg
cccaacgcgttcaagccgttcggctcgggccagcgcgcctgcatcggacgccagttcgcg
atgcaggaggcggtgctcgtcctgggcatgctgttgcagcgcttcgacttcgtcgaccac
ctgggctacgagctgaagatcaaggaggcgctcaccctcaagcccgagggcctgttcatc
cagctgcgcccacgacccgaccggaccaccggcaccgtcgtcgtcgccccgaacgccgcc
caggcgccggccgccaagccgaagctgcggctcgcgcccgtcggcgaccggcacggcacc
ccgctcaccgtgctgttcggctcgaacctcggcaccgccgagggcatcgcgacgcgcatc
gcccaggacggcgccgaccgcggcttcgccgtcaccctcggcgcactcgacgaccacgtc
gcggacctgccgaaggagggcgggctcgtcgtcgtctgcgcgtcgtacaacgggatgcca
ccggacaacgccgagcggttctgcgcctggatccgtgacgcggcgacccccgccgacacg
gccgccggcgcggcgtacgcggtgttcggctgcggcaacatggactgggcgtcgacctac
caggcgatccccaccatgctcgacgagcagctggagcggcacggcggacggcgggtcgtc
ccccgcggcgagggcgacgcgcgctcggacttcgacggccagtacgaggcgtggtacgcg
acactgtggccggcgatgaccgaggcgctcgggctcgagaccgcagccgtcggcaccgcc
gcggcgggtccgcggctgaccgtgacgatgaccaaccggcagaccaccaacccggtcgtc
gtctcctaccgggcccggccgtcgaccgtgcgggtcaaccgcgagctcaacctcgacggt
gccgaccggtcgacccgccatgtcgagatcgcgctggcgccgggcaccgagtaccagacc
ggcgaccacctcggtgtgttgccccgcaacaacgtcgatctgatccgccgggtgatcgcc
cgcttcaagctcgacgcgggcacctacgtgacgatcacgcccaccggcggctcgtggacc
catctcccgctcgacgagccggcgccgctgctgggggtgctgggcagctgcgtcgagctg
caggacgtcgccggacgctccgacatcgcgaccctcgcggcgtccgcgaccgacccggcc
gagcgcgaggcactgcaggccctcaccacgctcgacgacgagggccgggcccggtaccgc
aagacgatcgccgagccccgcgtgacggtgctcgacctgctcgacgcgtaccccagctgc
gacctgtcgttcgcgcagttcctcgacatgttgccgccgctgcggccccggtactactcg
atctcgtcggcgccctcggagtccgagacctgccacatcaccgtcggcgtgctcgacgtg
cccgcccgtggccgcgacggccggttcgcgggcgtgtgctcgacgcacctgcgcagctgc
gagacggactcgaccgtgttcaccttcgtccgcagaccgacgatcccgttccggccgccg
gagaacccgcacacaccgatgatcatggtcggggcgggcaccggcatggcgccgttccgc
gggttcctgcaggagcgggcggggctcaggcggcgcggggtgcccgtcggcgagtcactg
ctgttcttcggctgccgcacgcccgagcaggacttcctctactccgacgagctccgggcc
ttcgaacgcgacggcatcgtgcggctctgcatggccttctcccgcgtcgccgacaaccgg
cgctacgtgcagcaggcgatcctcgacgagcaggaggacgtgcgcaggctgctcgaccag
ggtgcgcacgtgtacgtgtgcggcaacgcgaacacgatggcgccggcggtccgtgccgcg
ctgatcgaggtgcaccagggcggcgacggcacggccgacaccgacggtgacgcctggctc
gcgggcctgcgtgccgcgcagcgctacctggaggacatctggggcgagagcgcggtcggc
tga

DBGET integrated database retrieval system