KEGG   Pseudonocardia dioxanivorans: Psed_6123Help
Entry
Psed_6123         CDS       T01479                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00790  Folate biosynthesis
pdx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psed_6123
Enzymes [BR:pdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Psed_6123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AEA28225
JGI: Psed_6123
UniProt: F4CLU3
Position
complement(6478661..6479185)
Genome map
AA seq 174 aa AA seqDB search
MTRAVLSLGSNLGDRIAHLRAVVDDMADVLVAASPVYETAPWGGIEQPDFLNAVIVVDDP
GTDAWGWLRRGQRLEQAAHRVREQRWGPRTLDVDVVAVTADGADVISDDPELVLPHPGTS
ERATVLVPWLDVDPGAVLAGRGPVRTLLDALPAGEIADVRRRDDLPLVVGSDAR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggccgtgctgagcctcggctccaacctcggcgaccggatcgcgcacctgcgc
gcggtcgtcgacgacatggccgacgtgctcgtcgccgcctccccggtctacgagacggcg
ccgtggggcgggatcgagcagcccgacttcctcaacgccgtgatcgtcgtcgacgacccg
gggaccgacgcctggggctggctgcgccgtgggcagcggttggagcaggcggcgcaccgg
gtccgtgagcagcggtggggcccgcgcacgctcgacgtcgacgtcgtcgcggtcaccgcc
gacggcgccgacgtgatcagcgacgatcccgagctggtgctgccgcatcccggcacgtcc
gagcgcgccacggtgctcgtcccctggctcgacgtcgacccgggcgcggtgctggccggg
cgcggtccggtccgcaccctcctcgacgcgttgccggccggcgagatcgccgacgtccgc
cgtcgcgacgacctgccgctcgtcgtgggcagcgacgcgagatga

DBGET integrated database retrieval system