KEGG   Pectobacterium sp. SCC3193: W5S_0072Help
Entry
W5S_0072          CDS       T02514                                 

Definition
Cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pec  Pectobacterium sp. SCC3193
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(81686..82801)
Genome map
AA seq 371 aa AA seqDB search
MPRVLRYLIPTLLWLWVSVAAAAVCDWPAWEQYKQHYISEQGRVIDTTSPNKITTSEGQS
YAMFFALVANDREMFERLRQWTENNLSAGDLGANLPAWLWGESKDKQWTVLDPNSASDAD
LWIAYNLLEAGRLWKDTRYKTLGTTLLKRIAREEVVNIPGLGMMLLPGKVGFTEKESWRL
NPSYLPPQLLARFAPLGETWKSMQRTTQRLLLETAPKGFSPDWVIWQKDKGWQPDTTKPN
IGSYDAIRVYLWVGMMADSSRGKADLIKQFQPMIQQTVQQGLPPEKTDTATGAVTGQGSV
GFSASLLPMLSRQPDALTIQRQRLAADPPGDDAYFSASLTLFGQGWDEKRYRFTSQGQLL
PSRGSQCITTP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtgtgctgcgctacctgatccccacgctgctgtggctatgggtctccgttgcc
gccgcagccgtttgcgactggcccgcttgggaacagtacaaacagcattacatcagcgag
caagggcgggtgattgataccacctcccccaataaaatcaccacttccgaagggcaaagt
tacgccatgttctttgccctggtcgccaacgatcgagaaatgtttgagcgactgcggcaa
tggacggaaaacaacctgtctgctggcgatttaggggccaatctgcccgcctggctatgg
ggagaaagcaaagataaacagtggacggtgctagaccctaactccgcgtccgacgccgat
ctgtggatcgcctataacctgcttgaagcgggccgactgtggaaagatacccgctataaa
acgctgggcaccacgctgcttaaacgtattgccagggaagaggtcgttaatattccgggt
ctgggcatgatgctcttgcccggcaaagtcggtttcacagagaaagagagctggcgttta
aaccccagttacctgccgccgcaattgctggcccgctttgcgccgttgggtgaaacgtgg
aagagcatgcagcgcaccacgcagcgcctgctattggaaaccgcaccgaaaggattttcg
cctgattgggtcatctggcaaaaagacaaaggctggcagcccgataccaccaaacccaat
atcggcagctatgacgccattcgcgtctatctgtgggtagggatgatggccgatagcagc
agaggaaaagccgacttgatcaaacagtttcagcccatgattcaacagacggtccaacaa
gggttgccacctgaaaaaacggacacggcaacaggtgccgtcaccgggcagggatcggta
ggattttccgcctcgctgctcccgatgctatcccgtcagccggatgcgttgaccatccag
cgacaacggctcgccgcggatccaccgggtgacgatgcctatttctcggcttctctgacg
ctctttggtcagggatgggatgagaagcgctaccgcttcacgtcacaaggccaactttta
ccgtcgcggggcagccaatgcataacaacaccgtaa

DBGET integrated database retrieval system